Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1D8K3

Protein Details
Accession A0A2V1D8K3    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
31-53PLDPARRRRVHKKSKAGCHTCKABasic
NLS Segment(s)
PositionSequence
36-45RRRRVHKKSK
Subcellular Location(s) mito 12, nucl 11.5, cyto_nucl 7.5, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MDQFTNTFVLSASSNQGSRLRELREIPQCLPLDPARRRRVHKKSKAGCHTCKARRLKVSKSEIALSSIW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.17
3 0.21
4 0.21
5 0.24
6 0.27
7 0.27
8 0.28
9 0.31
10 0.36
11 0.39
12 0.41
13 0.39
14 0.41
15 0.38
16 0.34
17 0.35
18 0.3
19 0.31
20 0.33
21 0.41
22 0.42
23 0.47
24 0.53
25 0.61
26 0.69
27 0.71
28 0.76
29 0.78
30 0.79
31 0.84
32 0.89
33 0.87
34 0.82
35 0.79
36 0.8
37 0.75
38 0.75
39 0.73
40 0.71
41 0.71
42 0.72
43 0.73
44 0.72
45 0.74
46 0.72
47 0.67
48 0.63
49 0.55