Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1DD71

Protein Details
Accession A0A2V1DD71   
Localization Confidence Low
Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
86-111AYHNAHPTKPKLHKKFKSLTGKQDAVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 11.833, cyto 8, cyto_pero 5.333, pero 1.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016197  Chromo-like_dom_sf  
IPR000953  Chromo/chromo_shadow_dom  
IPR023780  Chromo_domain  
Gene Ontology GO:0006338  P:chromatin remodeling  
Pfam View protein in Pfam  
PF00385  Chromo  
PROSITE View protein in PROSITE  
PS50013  CHROMO_2  
CDD cd00024  CD_CSD  
Amino Acid Sequences DPLPDQQTDKEPSFDVQPPDVDDDTDYAIESILDVRVNNDERDPLLRNRKGLLQYLCKWKDYPEGDDNPSWEPYMNVVGASDLVEAYHNAHPTKPKLHKKFKSLTGKQDAVV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.31
3 0.28
4 0.27
5 0.27
6 0.3
7 0.29
8 0.24
9 0.19
10 0.17
11 0.16
12 0.15
13 0.13
14 0.08
15 0.08
16 0.07
17 0.06
18 0.06
19 0.05
20 0.06
21 0.05
22 0.06
23 0.11
24 0.13
25 0.13
26 0.13
27 0.13
28 0.14
29 0.17
30 0.19
31 0.22
32 0.3
33 0.31
34 0.31
35 0.32
36 0.36
37 0.35
38 0.37
39 0.35
40 0.32
41 0.35
42 0.43
43 0.43
44 0.4
45 0.38
46 0.33
47 0.37
48 0.32
49 0.34
50 0.3
51 0.32
52 0.34
53 0.35
54 0.35
55 0.29
56 0.27
57 0.22
58 0.16
59 0.12
60 0.11
61 0.12
62 0.1
63 0.08
64 0.08
65 0.07
66 0.08
67 0.08
68 0.06
69 0.04
70 0.04
71 0.05
72 0.05
73 0.09
74 0.11
75 0.14
76 0.14
77 0.17
78 0.23
79 0.27
80 0.37
81 0.43
82 0.52
83 0.6
84 0.71
85 0.76
86 0.8
87 0.85
88 0.85
89 0.86
90 0.83
91 0.82
92 0.81