Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q2ULZ6

Protein Details
Accession Q2ULZ6    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
123-151KGTRNKVLMSRKDPRKYKRRPGSTPGGSSHydrophilic
NLS Segment(s)
PositionSequence
126-155RNKVLMSRKDPRKYKRRPGSTPGGSSSKKK
Subcellular Location(s) mito 21.5, cyto_mito 12, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR008913  Znf_CHY  
IPR037274  Znf_CHY_sf  
Gene Ontology GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF05495  zf-CHY  
PROSITE View protein in PROSITE  
PS51266  ZF_CHY  
Amino Acid Sequences MVFKLPEVKFLRVGSAAFTSRNQALPRKKPKEALGIVAGQELPRRGRCSHYGKSYRWFRFSCCAKVFPCDKCHDAETDHPNEHANRMICGFCSREQIYRPENCGVCRAVLIGKAGSGFWEGGKGTRNKVLMSRKDPRKYKRRPGSTPGGSSSKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.25
3 0.23
4 0.21
5 0.21
6 0.22
7 0.22
8 0.26
9 0.27
10 0.31
11 0.39
12 0.48
13 0.59
14 0.62
15 0.65
16 0.67
17 0.69
18 0.71
19 0.63
20 0.58
21 0.5
22 0.44
23 0.4
24 0.34
25 0.29
26 0.19
27 0.18
28 0.15
29 0.15
30 0.16
31 0.2
32 0.2
33 0.25
34 0.32
35 0.39
36 0.44
37 0.51
38 0.55
39 0.54
40 0.62
41 0.67
42 0.64
43 0.62
44 0.55
45 0.48
46 0.5
47 0.52
48 0.51
49 0.44
50 0.43
51 0.38
52 0.42
53 0.44
54 0.39
55 0.38
56 0.34
57 0.33
58 0.31
59 0.31
60 0.27
61 0.24
62 0.26
63 0.27
64 0.27
65 0.26
66 0.24
67 0.25
68 0.24
69 0.23
70 0.2
71 0.15
72 0.12
73 0.13
74 0.13
75 0.12
76 0.14
77 0.15
78 0.12
79 0.17
80 0.18
81 0.2
82 0.22
83 0.27
84 0.31
85 0.32
86 0.35
87 0.34
88 0.34
89 0.32
90 0.33
91 0.28
92 0.23
93 0.19
94 0.17
95 0.12
96 0.12
97 0.13
98 0.1
99 0.09
100 0.09
101 0.09
102 0.09
103 0.09
104 0.08
105 0.06
106 0.08
107 0.08
108 0.1
109 0.16
110 0.18
111 0.19
112 0.24
113 0.26
114 0.25
115 0.33
116 0.41
117 0.43
118 0.5
119 0.58
120 0.63
121 0.71
122 0.79
123 0.82
124 0.83
125 0.85
126 0.88
127 0.89
128 0.89
129 0.88
130 0.87
131 0.87
132 0.85
133 0.8
134 0.74
135 0.72