Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T6ZPS9

Protein Details
Accession A0A2T6ZPS9    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-40MGNSQSRHKKRRQKEPPAAKPTKKFAKKTKATRAPSPDTVHydrophilic
NLS Segment(s)
PositionSequence
7-33RHKKRRQKEPPAAKPTKKFAKKTKATR
Subcellular Location(s) nucl 16, mito_nucl 13.5, mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR014764  DCN-prot  
IPR042460  DCN1-like_PONY  
IPR005176  PONY_dom  
Pfam View protein in Pfam  
PF03556  Cullin_binding  
PROSITE View protein in PROSITE  
PS51229  DCUN1  
Amino Acid Sequences MGNSQSRHKKRRQKEPPAAKPTKKFAKKTKATRAPSPDTVLTRWFDELKGDTDEIMITDSVPWMESLGVSPEGIAFWVIAYWCAAEGRGAIRLKEFMEGMKALGIDSNNSLRRQLPTLLRDVAPGSDRFQKFYWFCYEFFKAADAKYLPLDMACEMFTVLLDERSYSTKWTPPAESNSSLKVKQPITWEKFPHKHAFLEFLGSTPPPTKVITKDQYRQFIPFNEQVDTDFKGYAIETSVWPSLFDQFVTWSKEKQPKDENSMDQSELP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.93
3 0.94
4 0.94
5 0.94
6 0.91
7 0.87
8 0.85
9 0.85
10 0.83
11 0.81
12 0.81
13 0.82
14 0.84
15 0.87
16 0.89
17 0.88
18 0.85
19 0.86
20 0.84
21 0.8
22 0.74
23 0.69
24 0.63
25 0.56
26 0.51
27 0.46
28 0.38
29 0.32
30 0.3
31 0.26
32 0.21
33 0.21
34 0.21
35 0.2
36 0.22
37 0.2
38 0.18
39 0.17
40 0.17
41 0.14
42 0.13
43 0.09
44 0.06
45 0.06
46 0.07
47 0.06
48 0.06
49 0.06
50 0.05
51 0.05
52 0.05
53 0.06
54 0.08
55 0.08
56 0.08
57 0.08
58 0.08
59 0.07
60 0.07
61 0.07
62 0.04
63 0.03
64 0.04
65 0.04
66 0.04
67 0.05
68 0.04
69 0.05
70 0.05
71 0.05
72 0.05
73 0.05
74 0.06
75 0.12
76 0.13
77 0.13
78 0.13
79 0.15
80 0.15
81 0.16
82 0.15
83 0.09
84 0.11
85 0.11
86 0.1
87 0.1
88 0.09
89 0.08
90 0.09
91 0.09
92 0.07
93 0.08
94 0.13
95 0.15
96 0.16
97 0.17
98 0.17
99 0.18
100 0.2
101 0.23
102 0.24
103 0.23
104 0.26
105 0.27
106 0.26
107 0.25
108 0.23
109 0.19
110 0.15
111 0.14
112 0.13
113 0.19
114 0.19
115 0.21
116 0.21
117 0.26
118 0.24
119 0.26
120 0.3
121 0.24
122 0.25
123 0.27
124 0.29
125 0.24
126 0.24
127 0.23
128 0.17
129 0.15
130 0.18
131 0.13
132 0.12
133 0.11
134 0.11
135 0.1
136 0.08
137 0.09
138 0.06
139 0.06
140 0.06
141 0.05
142 0.05
143 0.05
144 0.05
145 0.06
146 0.05
147 0.06
148 0.06
149 0.06
150 0.07
151 0.1
152 0.1
153 0.11
154 0.13
155 0.16
156 0.19
157 0.22
158 0.24
159 0.25
160 0.32
161 0.34
162 0.36
163 0.34
164 0.36
165 0.37
166 0.35
167 0.33
168 0.33
169 0.29
170 0.29
171 0.35
172 0.4
173 0.44
174 0.5
175 0.52
176 0.55
177 0.6
178 0.62
179 0.61
180 0.53
181 0.49
182 0.44
183 0.44
184 0.35
185 0.34
186 0.29
187 0.22
188 0.21
189 0.18
190 0.18
191 0.14
192 0.15
193 0.12
194 0.14
195 0.17
196 0.2
197 0.3
198 0.37
199 0.43
200 0.5
201 0.56
202 0.6
203 0.59
204 0.58
205 0.52
206 0.47
207 0.46
208 0.44
209 0.39
210 0.33
211 0.32
212 0.31
213 0.3
214 0.29
215 0.23
216 0.18
217 0.15
218 0.14
219 0.14
220 0.13
221 0.12
222 0.11
223 0.11
224 0.14
225 0.17
226 0.16
227 0.17
228 0.17
229 0.18
230 0.17
231 0.17
232 0.14
233 0.16
234 0.21
235 0.27
236 0.28
237 0.28
238 0.37
239 0.45
240 0.47
241 0.52
242 0.57
243 0.57
244 0.65
245 0.7
246 0.67
247 0.65
248 0.66