Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T6ZDZ4

Protein Details
Accession A0A2T6ZDZ4    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
77-101GEGAGATKKKRPRKRKAVEPAEGDGBasic
NLS Segment(s)
PositionSequence
81-93GATKKKRPRKRKA
Subcellular Location(s) nucl 13, mito 9, cyto 4
Family & Domain DBs
Amino Acid Sequences MPPKAADKDNSKFLYSILKQINTKGVNWEQVAQENDIPTANAASMRWYRYQVSMSPDGKTPPKKKVEGNDGGETGEGEGAGATKKKRPRKRKAVEPAEGDGGSPNG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.36
3 0.39
4 0.35
5 0.37
6 0.37
7 0.39
8 0.46
9 0.37
10 0.37
11 0.35
12 0.32
13 0.32
14 0.32
15 0.32
16 0.25
17 0.29
18 0.3
19 0.24
20 0.23
21 0.18
22 0.18
23 0.15
24 0.14
25 0.09
26 0.08
27 0.06
28 0.05
29 0.05
30 0.08
31 0.1
32 0.13
33 0.14
34 0.15
35 0.16
36 0.18
37 0.2
38 0.18
39 0.21
40 0.27
41 0.26
42 0.25
43 0.25
44 0.26
45 0.3
46 0.36
47 0.35
48 0.36
49 0.41
50 0.43
51 0.47
52 0.53
53 0.57
54 0.57
55 0.58
56 0.53
57 0.47
58 0.44
59 0.39
60 0.31
61 0.22
62 0.13
63 0.07
64 0.04
65 0.04
66 0.04
67 0.05
68 0.08
69 0.1
70 0.16
71 0.25
72 0.35
73 0.46
74 0.57
75 0.67
76 0.76
77 0.85
78 0.9
79 0.93
80 0.93
81 0.9
82 0.85
83 0.78
84 0.71
85 0.6
86 0.5