Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T6ZI43

Protein Details
Accession A0A2T6ZI43   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
66-88RESYLSYRRHHRRKRTWLRGAIAHydrophilic
NLS Segment(s)
PositionSequence
77-79RRK
Subcellular Location(s) extr 18, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR016185  PreATP-grasp_dom_sf  
Amino Acid Sequences MALPRSLALWALLPSLIASSRKAARSLSLLPKLLPTPPATGNSPPKTTADSQRWLSIQQAVCSLLRESYLSYRRHHRRKRTWLRGAIAGGRDLVDVTKVQVIGSGGLSIGQAGEFDYSGKGAIFCFGDES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.1
3 0.11
4 0.1
5 0.11
6 0.15
7 0.2
8 0.22
9 0.23
10 0.23
11 0.23
12 0.27
13 0.33
14 0.37
15 0.37
16 0.36
17 0.35
18 0.37
19 0.36
20 0.32
21 0.27
22 0.2
23 0.19
24 0.2
25 0.23
26 0.23
27 0.28
28 0.35
29 0.37
30 0.37
31 0.34
32 0.33
33 0.34
34 0.34
35 0.36
36 0.33
37 0.34
38 0.34
39 0.35
40 0.35
41 0.32
42 0.3
43 0.27
44 0.23
45 0.18
46 0.18
47 0.16
48 0.16
49 0.16
50 0.15
51 0.1
52 0.09
53 0.08
54 0.08
55 0.13
56 0.19
57 0.21
58 0.23
59 0.33
60 0.43
61 0.53
62 0.61
63 0.66
64 0.7
65 0.79
66 0.88
67 0.89
68 0.89
69 0.86
70 0.8
71 0.73
72 0.65
73 0.57
74 0.46
75 0.35
76 0.26
77 0.19
78 0.16
79 0.11
80 0.09
81 0.07
82 0.06
83 0.07
84 0.08
85 0.08
86 0.08
87 0.1
88 0.1
89 0.1
90 0.1
91 0.09
92 0.07
93 0.07
94 0.07
95 0.05
96 0.05
97 0.04
98 0.04
99 0.04
100 0.05
101 0.05
102 0.06
103 0.06
104 0.07
105 0.07
106 0.08
107 0.07
108 0.07
109 0.09
110 0.09