Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T6ZTB9

Protein Details
Accession A0A2T6ZTB9   
Localization Confidence Low
Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
26-55LSQKHQFRLERRYRRRMKLKFARPRLQKVVHydrophilic
NLS Segment(s)
PositionSequence
35-50ERRYRRRMKLKFARPR
Subcellular Location(s) mito 16, nucl 5, plas 3, cyto 2
Family & Domain DBs
Amino Acid Sequences MFPTRALLVQKVYKAKKPWPPDFSLLSQKHQFRLERRYRRRMKLKFARPRLQKVVKLAQGVIISTLAIWAVFINDWGERGNRPVQPLRDWVSDLKKSFWSTPSRPKLSGQPRTPSSSGSISEASSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.57
3 0.6
4 0.65
5 0.69
6 0.66
7 0.68
8 0.66
9 0.65
10 0.61
11 0.63
12 0.56
13 0.52
14 0.52
15 0.48
16 0.47
17 0.48
18 0.48
19 0.44
20 0.52
21 0.57
22 0.61
23 0.68
24 0.75
25 0.79
26 0.84
27 0.88
28 0.85
29 0.85
30 0.85
31 0.86
32 0.86
33 0.86
34 0.85
35 0.81
36 0.81
37 0.79
38 0.75
39 0.68
40 0.63
41 0.61
42 0.54
43 0.49
44 0.41
45 0.34
46 0.27
47 0.24
48 0.18
49 0.11
50 0.07
51 0.06
52 0.06
53 0.03
54 0.03
55 0.03
56 0.02
57 0.03
58 0.03
59 0.03
60 0.04
61 0.04
62 0.05
63 0.06
64 0.07
65 0.07
66 0.1
67 0.15
68 0.16
69 0.2
70 0.25
71 0.28
72 0.3
73 0.34
74 0.36
75 0.33
76 0.34
77 0.34
78 0.36
79 0.39
80 0.37
81 0.35
82 0.34
83 0.35
84 0.36
85 0.37
86 0.38
87 0.4
88 0.49
89 0.56
90 0.57
91 0.56
92 0.57
93 0.61
94 0.64
95 0.67
96 0.63
97 0.63
98 0.62
99 0.67
100 0.65
101 0.56
102 0.5
103 0.44
104 0.39
105 0.34
106 0.31