Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q2UJL2

Protein Details
Accession Q2UJL2    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
238-257YGIGKSKSQRLRKSRSEFYHHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 12, mito 4, plas 4, E.R. 4, golg 2, mito_nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR028000  Pma1  
Gene Ontology GO:0016020  C:membrane  
KEGG aor:AO090003001167  -  
Pfam View protein in Pfam  
PF14610  Psg1  
Amino Acid Sequences MRSLVPFPKVIALVTTTTALYSHCLGAAVQGTDELGPSPAVGWIEESKTTAHLQTNNASPDDFPVCTDIDGPFAPFCLPQDGADVIVDATYYVTWNADFYPLNASITIEMRYSNSTVGDSAFTSEKTDNSYGYLPLHMRKEWLQEKAHNDLTFYLIELNPASGTRASIRKGPRITLHPKPVEHYKPSPPMTFNKRALFIGLPVSLSVIIVVVAGLFFGMRESRRIGLGSVMGSRGKGYGIGKSKSQRLRKSRSEFYHSNAASALKKYTDDTDSGLSEVADPDLHSEIERTARFAFRQDSMRLKSWRRQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.14
4 0.13
5 0.13
6 0.12
7 0.12
8 0.12
9 0.11
10 0.1
11 0.11
12 0.1
13 0.13
14 0.15
15 0.13
16 0.11
17 0.11
18 0.11
19 0.11
20 0.11
21 0.09
22 0.07
23 0.06
24 0.06
25 0.06
26 0.08
27 0.08
28 0.08
29 0.1
30 0.12
31 0.14
32 0.15
33 0.15
34 0.14
35 0.16
36 0.18
37 0.18
38 0.2
39 0.22
40 0.24
41 0.28
42 0.33
43 0.33
44 0.32
45 0.29
46 0.25
47 0.25
48 0.25
49 0.2
50 0.15
51 0.15
52 0.15
53 0.15
54 0.16
55 0.12
56 0.12
57 0.12
58 0.12
59 0.1
60 0.1
61 0.11
62 0.1
63 0.11
64 0.12
65 0.12
66 0.11
67 0.15
68 0.14
69 0.14
70 0.14
71 0.13
72 0.09
73 0.08
74 0.07
75 0.04
76 0.04
77 0.04
78 0.04
79 0.04
80 0.04
81 0.05
82 0.05
83 0.06
84 0.08
85 0.08
86 0.08
87 0.12
88 0.12
89 0.13
90 0.13
91 0.12
92 0.11
93 0.12
94 0.13
95 0.09
96 0.09
97 0.09
98 0.1
99 0.11
100 0.1
101 0.09
102 0.09
103 0.09
104 0.09
105 0.09
106 0.08
107 0.09
108 0.09
109 0.08
110 0.1
111 0.11
112 0.11
113 0.14
114 0.14
115 0.13
116 0.14
117 0.15
118 0.13
119 0.13
120 0.15
121 0.12
122 0.15
123 0.17
124 0.15
125 0.16
126 0.17
127 0.24
128 0.26
129 0.3
130 0.3
131 0.32
132 0.35
133 0.39
134 0.41
135 0.33
136 0.29
137 0.24
138 0.23
139 0.19
140 0.15
141 0.11
142 0.07
143 0.08
144 0.07
145 0.07
146 0.05
147 0.05
148 0.06
149 0.05
150 0.06
151 0.08
152 0.11
153 0.12
154 0.17
155 0.21
156 0.26
157 0.28
158 0.3
159 0.31
160 0.36
161 0.41
162 0.43
163 0.49
164 0.46
165 0.45
166 0.46
167 0.51
168 0.49
169 0.47
170 0.44
171 0.42
172 0.46
173 0.49
174 0.48
175 0.42
176 0.45
177 0.48
178 0.51
179 0.5
180 0.45
181 0.44
182 0.42
183 0.41
184 0.34
185 0.27
186 0.21
187 0.16
188 0.13
189 0.11
190 0.11
191 0.09
192 0.08
193 0.07
194 0.04
195 0.03
196 0.03
197 0.03
198 0.02
199 0.02
200 0.02
201 0.02
202 0.02
203 0.02
204 0.03
205 0.05
206 0.06
207 0.08
208 0.11
209 0.12
210 0.13
211 0.14
212 0.14
213 0.14
214 0.15
215 0.14
216 0.13
217 0.14
218 0.13
219 0.12
220 0.12
221 0.11
222 0.09
223 0.11
224 0.11
225 0.17
226 0.24
227 0.26
228 0.31
229 0.35
230 0.44
231 0.49
232 0.58
233 0.6
234 0.63
235 0.71
236 0.76
237 0.79
238 0.81
239 0.8
240 0.79
241 0.72
242 0.67
243 0.68
244 0.58
245 0.5
246 0.41
247 0.37
248 0.31
249 0.3
250 0.27
251 0.18
252 0.19
253 0.2
254 0.23
255 0.22
256 0.21
257 0.22
258 0.23
259 0.22
260 0.22
261 0.2
262 0.16
263 0.15
264 0.14
265 0.11
266 0.09
267 0.08
268 0.1
269 0.11
270 0.11
271 0.11
272 0.11
273 0.13
274 0.19
275 0.2
276 0.2
277 0.22
278 0.26
279 0.26
280 0.3
281 0.32
282 0.3
283 0.36
284 0.39
285 0.45
286 0.47
287 0.54
288 0.57