FuNGI

A0A2T7A2M5

Protein Details

Accession

A0A2T7A2M5

Localization Confidence

Low

Confidence Score

9.1

NoLS Segment(s)

Position	Sequence	Protein Nature
382-454	LGATKKTKGKGKESKERPKTPKTPKTPTKEAPPPKTPKTPKTPSKDASKTPKTPSRDPPKTPKTPSREAQKTP	Hydrophilic

NLS Segment(s)

Position	Sequence
372-452	KRLRKLGAMYLGATKKTKGKGKESKERPKTPKTPKTPTKEAPPPKTPKTPKTPSKDASKTPKTPSRDPPKTPKTPSREAQK

Subcellular Location(s)

mito 19.5, cyto_mito 11.333, nucl 4.5, cyto_nucl 3.833

Family & Domain DBs

InterPro	View protein in InterPro IPR013909 NIPA/Rsm1_C IPR012935 Znf_C3HC-like
Gene Ontology	GO:0005634 C:nucleus GO:0008270 F:zinc ion binding
Pfam	View protein in Pfam PF08600 Rsm1 PF07967 zf-C3HC

Amino Acid Sequences

MLYSTKRKLHNLINGPPAPSTSISAPSTPAKQPTDLPTTTTAAFDDNDVVLIAPAVADAAKKRRLGGLGNRSRPSVRAVSPTGSIRSTVSTTSSQQMPTYSPWDRAAFLERLRTYRFVDKWSAKPVDVNEVEWARRGWSCIDKNRVRCGVCKREVVVKVELDEEQDSDITKAVVEKYKEMIVTEHEDRCLWKKRGCDDTIYRLQLANPSVSRPSFVSRYSSLLRIRPEIPPSLSYPTADFPEHILETIHENTLLLEEQHSGALVLALFGWQNEDPGIPSLVTCSACFRRLGLWLFRKKVVSIFDSVDEQEEASVCRLDVIGEHRDYCPWINATNQGTEPGWQIMLRILQQPNKGPALGSYTERDAEDQSKLKRLRKLGAMYLGATKKTKGKGKESKERPKTPKTPKTPTKEAPPPKTPKTPKTPSKDASKTPKTPSRDPPKTPKTPSREAQKTPGRSEE

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.68
2	0.63
3	0.56
4	0.48
5	0.41
6	0.33
7	0.28
8	0.21
9	0.24
10	0.25
11	0.25
12	0.27
13	0.29
14	0.32
15	0.33
16	0.38
17	0.35
18	0.35
19	0.39
20	0.42
21	0.46
22	0.41
23	0.4
24	0.37
25	0.37
26	0.35
27	0.31
28	0.25
29	0.19
30	0.19
31	0.16
32	0.14
33	0.11
34	0.11
35	0.1
36	0.1
37	0.08
38	0.08
39	0.06
40	0.04
41	0.04
42	0.04
43	0.04
44	0.05
45	0.09
46	0.16
47	0.22
48	0.23
49	0.24
50	0.28
51	0.31
52	0.38
53	0.44
54	0.49
55	0.53
56	0.6
57	0.61
58	0.59
59	0.57
60	0.51
61	0.46
62	0.41
63	0.35
64	0.33
65	0.35
66	0.35
67	0.38
68	0.39
69	0.36
70	0.3
71	0.28
72	0.22
73	0.21
74	0.2
75	0.18
76	0.18
77	0.18
78	0.2
79	0.23
80	0.25
81	0.23
82	0.23
83	0.23
84	0.22
85	0.22
86	0.27
87	0.25
88	0.26
89	0.28
90	0.29
91	0.28
92	0.28
93	0.3
94	0.28
95	0.27
96	0.32
97	0.3
98	0.32
99	0.34
100	0.35
101	0.33
102	0.38
103	0.38
104	0.34
105	0.41
106	0.44
107	0.46
108	0.51
109	0.5
110	0.42
111	0.43
112	0.4
113	0.4
114	0.35
115	0.31
116	0.27
117	0.27
118	0.27
119	0.25
120	0.24
121	0.17
122	0.16
123	0.17
124	0.16
125	0.22
126	0.29
127	0.36
128	0.45
129	0.5
130	0.55
131	0.61
132	0.64
133	0.56
134	0.56
135	0.58
136	0.58
137	0.56
138	0.55
139	0.49
140	0.51
141	0.53
142	0.51
143	0.44
144	0.35
145	0.31
146	0.29
147	0.27
148	0.2
149	0.17
150	0.13
151	0.1
152	0.09
153	0.09
154	0.08
155	0.08
156	0.06
157	0.06
158	0.07
159	0.09
160	0.13
161	0.13
162	0.15
163	0.16
164	0.18
165	0.18
166	0.17
167	0.16
168	0.14
169	0.18
170	0.21
171	0.2
172	0.19
173	0.19
174	0.2
175	0.25
176	0.31
177	0.3
178	0.29
179	0.34
180	0.39
181	0.47
182	0.47
183	0.48
184	0.43
185	0.47
186	0.51
187	0.47
188	0.41
189	0.34
190	0.33
191	0.29
192	0.26
193	0.2
194	0.14
195	0.14
196	0.15
197	0.15
198	0.16
199	0.13
200	0.15
201	0.15
202	0.16
203	0.18
204	0.18
205	0.22
206	0.22
207	0.26
208	0.25
209	0.26
210	0.27
211	0.26
212	0.26
213	0.25
214	0.26
215	0.24
216	0.23
217	0.21
218	0.21
219	0.22
220	0.2
221	0.18
222	0.17
223	0.16
224	0.16
225	0.15
226	0.13
227	0.1
228	0.13
229	0.12
230	0.11
231	0.1
232	0.08
233	0.11
234	0.12
235	0.11
236	0.08
237	0.08
238	0.08
239	0.09
240	0.08
241	0.05
242	0.05
243	0.05
244	0.06
245	0.06
246	0.06
247	0.05
248	0.05
249	0.05
250	0.04
251	0.04
252	0.03
253	0.03
254	0.03
255	0.03
256	0.05
257	0.05
258	0.05
259	0.06
260	0.06
261	0.06
262	0.08
263	0.08
264	0.06
265	0.06
266	0.07
267	0.09
268	0.1
269	0.1
270	0.13
271	0.15
272	0.16
273	0.17
274	0.17
275	0.16
276	0.2
277	0.24
278	0.27
279	0.34
280	0.4
281	0.42
282	0.44
283	0.44
284	0.4
285	0.4
286	0.35
287	0.28
288	0.24
289	0.23
290	0.22
291	0.22
292	0.22
293	0.19
294	0.15
295	0.13
296	0.1
297	0.08
298	0.08
299	0.08
300	0.08
301	0.06
302	0.06
303	0.06
304	0.06
305	0.08
306	0.11
307	0.15
308	0.16
309	0.18
310	0.18
311	0.19
312	0.2
313	0.2
314	0.19
315	0.15
316	0.16
317	0.16
318	0.22
319	0.23
320	0.24
321	0.23
322	0.22
323	0.21
324	0.21
325	0.2
326	0.15
327	0.14
328	0.11
329	0.11
330	0.11
331	0.13
332	0.14
333	0.18
334	0.22
335	0.26
336	0.3
337	0.34
338	0.36
339	0.35
340	0.33
341	0.27
342	0.24
343	0.26
344	0.24
345	0.22
346	0.2
347	0.21
348	0.22
349	0.22
350	0.22
351	0.19
352	0.2
353	0.22
354	0.26
355	0.27
356	0.34
357	0.4
358	0.45
359	0.49
360	0.52
361	0.53
362	0.56
363	0.59
364	0.56
365	0.56
366	0.52
367	0.47
368	0.49
369	0.44
370	0.38
371	0.34
372	0.3
373	0.29
374	0.35
375	0.41
376	0.41
377	0.49
378	0.57
379	0.66
380	0.75
381	0.8
382	0.83
383	0.87
384	0.9
385	0.88
386	0.88
387	0.89
388	0.89
389	0.89
390	0.88
391	0.88
392	0.87
393	0.88
394	0.87
395	0.83
396	0.82
397	0.82
398	0.83
399	0.81
400	0.81
401	0.81
402	0.78
403	0.83
404	0.81
405	0.8
406	0.8
407	0.82
408	0.82
409	0.82
410	0.85
411	0.8
412	0.82
413	0.81
414	0.79
415	0.8
416	0.8
417	0.78
418	0.78
419	0.79
420	0.76
421	0.77
422	0.78
423	0.79
424	0.79
425	0.8
426	0.82
427	0.84
428	0.86
429	0.87
430	0.86
431	0.83
432	0.83
433	0.82
434	0.82
435	0.81
436	0.77
437	0.78
438	0.78
439	0.77

A0A2T7A2M5

3D AlphaFold-predicted Structure Viewer