Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q2UDZ8

Protein Details
Accession Q2UDZ8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
77-106SPSSSPGRRRRGQSPRKARRQHRCHWSMCKHydrophilic
NLS Segment(s)
PositionSequence
83-96GRRRRGQSPRKARR
Subcellular Location(s) plas 12, extr 8, E.R. 3, golg 2
Family & Domain DBs
Amino Acid Sequences MPVAWSWAMRTATLAVVLLVLPLLVAVPVDELSLLLDPEEPVEVGKDVAVVVDEDEPEASDAFFEPHWLWASLHFSSPSSSPGRRRRGQSPRKARRQHRCHWSMCK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.09
3 0.08
4 0.08
5 0.06
6 0.05
7 0.04
8 0.03
9 0.03
10 0.03
11 0.02
12 0.02
13 0.02
14 0.03
15 0.03
16 0.04
17 0.04
18 0.04
19 0.04
20 0.05
21 0.05
22 0.04
23 0.05
24 0.05
25 0.05
26 0.05
27 0.05
28 0.04
29 0.05
30 0.05
31 0.05
32 0.05
33 0.04
34 0.04
35 0.04
36 0.04
37 0.03
38 0.04
39 0.04
40 0.04
41 0.04
42 0.04
43 0.04
44 0.05
45 0.05
46 0.04
47 0.04
48 0.04
49 0.05
50 0.05
51 0.06
52 0.06
53 0.08
54 0.1
55 0.11
56 0.11
57 0.12
58 0.17
59 0.16
60 0.17
61 0.16
62 0.15
63 0.15
64 0.16
65 0.18
66 0.18
67 0.22
68 0.3
69 0.39
70 0.48
71 0.53
72 0.58
73 0.65
74 0.71
75 0.78
76 0.8
77 0.82
78 0.84
79 0.88
80 0.93
81 0.93
82 0.93
83 0.91
84 0.9
85 0.9
86 0.87