Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T7A8S3

Protein Details
Accession A0A2T7A8S3    Localization Confidence Low Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
16-43LWKSPWRLSSNQKYRHRQRLRRVDRIVDHydrophilic
81-102FDPKQKSYRKGVHKLPKWTRMSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22, mito_nucl 13.333, cyto_nucl 3.166, nucl 2.5, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFSAFRPTQSRLGGLLWKSPWRLSSNQKYRHRQRLRRVDRIVDVVDKALAKQGMTATAVERWKSEMPTEAEMKPRDKYTMFDPKQKSYRKGVHKLPKWTRMSQRVNPPGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.32
3 0.29
4 0.31
5 0.31
6 0.3
7 0.31
8 0.3
9 0.34
10 0.39
11 0.47
12 0.53
13 0.62
14 0.7
15 0.77
16 0.82
17 0.87
18 0.88
19 0.86
20 0.87
21 0.88
22 0.87
23 0.87
24 0.82
25 0.75
26 0.67
27 0.62
28 0.52
29 0.42
30 0.33
31 0.23
32 0.2
33 0.15
34 0.12
35 0.11
36 0.1
37 0.08
38 0.08
39 0.08
40 0.08
41 0.09
42 0.09
43 0.07
44 0.11
45 0.12
46 0.12
47 0.12
48 0.14
49 0.15
50 0.15
51 0.15
52 0.17
53 0.18
54 0.21
55 0.24
56 0.23
57 0.27
58 0.29
59 0.31
60 0.28
61 0.26
62 0.26
63 0.24
64 0.24
65 0.26
66 0.35
67 0.36
68 0.43
69 0.46
70 0.51
71 0.59
72 0.64
73 0.61
74 0.59
75 0.66
76 0.67
77 0.71
78 0.74
79 0.76
80 0.77
81 0.83
82 0.83
83 0.84
84 0.8
85 0.79
86 0.79
87 0.79
88 0.8
89 0.77
90 0.79