Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T6ZSZ1

Protein Details
Accession A0A2T6ZSZ1   
Localization Confidence Medium
Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
39-69APSERKREMFPQKSKRQSTGPMHPKLRKKSTHydrophilic
NLS Segment(s)
PositionSequence
43-68RKREMFPQKSKRQSTGPMHPKLRKKS
Subcellular Location(s) nucl 15, mito 6, cyto 5
Family & Domain DBs
Amino Acid Sequences MIFEFTHLLTQEHGKRKGGGPNEQLREKAMITSIIHKTAPSERKREMFPQKSKRQSTGPMHPKLRKKST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.39
3 0.42
4 0.48
5 0.46
6 0.46
7 0.46
8 0.51
9 0.55
10 0.54
11 0.5
12 0.44
13 0.4
14 0.32
15 0.24
16 0.16
17 0.13
18 0.12
19 0.17
20 0.17
21 0.16
22 0.16
23 0.15
24 0.16
25 0.21
26 0.29
27 0.28
28 0.32
29 0.35
30 0.38
31 0.42
32 0.49
33 0.52
34 0.54
35 0.61
36 0.66
37 0.73
38 0.79
39 0.8
40 0.76
41 0.71
42 0.7
43 0.68
44 0.69
45 0.69
46 0.68
47 0.73
48 0.76
49 0.8