Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T6ZZT4

Protein Details
Accession A0A2T6ZZT4    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
47-67ITFFPKKKKRVVVRLLNDCLPHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 11, E.R. 7, mito 4, pero 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MVTDIVCLVTDLVYPIVPCMSGLYLKLHGRISKLASVGLFVVYFSFITFFPKKKKRVVVRLLNDCLPIVKVP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.07
4 0.07
5 0.07
6 0.07
7 0.07
8 0.07
9 0.08
10 0.1
11 0.15
12 0.16
13 0.18
14 0.19
15 0.19
16 0.21
17 0.22
18 0.22
19 0.2
20 0.19
21 0.17
22 0.15
23 0.14
24 0.12
25 0.1
26 0.08
27 0.05
28 0.05
29 0.04
30 0.05
31 0.04
32 0.05
33 0.05
34 0.11
35 0.14
36 0.18
37 0.28
38 0.36
39 0.41
40 0.48
41 0.59
42 0.63
43 0.71
44 0.77
45 0.78
46 0.8
47 0.84
48 0.81
49 0.73
50 0.63
51 0.53
52 0.44