Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2LF90

Protein Details
Accession E2LF90   
Localization Confidence High
Confidence Score 18.4
NoLS Segment(s)
PositionSequenceProtein Nature
37-56LVQASQPKKRGKKSDWPEAEHydrophilic
NLS Segment(s)
PositionSequence
6-33RPKKAAVEETPKSHPTAGKRSHKAKARS
43-49PKKRGKK
Subcellular Location(s) nucl 21, cyto 4
Family & Domain DBs
KEGG mpr:MPER_05045  -  
Amino Acid Sequences MAKGNRPKKAAVEETPKSHPTAGKRSHKAKARSISDLVQASQPKKRGKKSDWPEAELEFLKSRLPGYVETRGSKESFWSSLFPDFLAAFPQYKSSTPSDLKPCEEPGPDQPXEQPDAQATSGVQASSNDQTGDGTMDQAEDLGSWESNQKKITTWFYNHRNDDRRAVSQPLLKALSKPSRAPQRIPAFKRYMKLPEYVPKIAAEFKQKYLDDVEWDDDESLQELEDEETEGDEDSEKSIEAWHTLSNVEKKALLKTHSLVIRCHVAKYLFGKEKKSVRNQIEHDNNEDYENKLAEHKASKSMKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.66
3 0.6
4 0.53
5 0.49
6 0.45
7 0.43
8 0.47
9 0.52
10 0.57
11 0.64
12 0.7
13 0.74
14 0.79
15 0.78
16 0.77
17 0.77
18 0.72
19 0.69
20 0.66
21 0.6
22 0.57
23 0.52
24 0.44
25 0.39
26 0.39
27 0.36
28 0.38
29 0.42
30 0.46
31 0.52
32 0.6
33 0.65
34 0.67
35 0.74
36 0.77
37 0.81
38 0.79
39 0.74
40 0.68
41 0.59
42 0.55
43 0.45
44 0.39
45 0.29
46 0.23
47 0.19
48 0.17
49 0.16
50 0.14
51 0.15
52 0.16
53 0.2
54 0.28
55 0.31
56 0.33
57 0.35
58 0.36
59 0.35
60 0.31
61 0.28
62 0.23
63 0.21
64 0.21
65 0.2
66 0.2
67 0.22
68 0.22
69 0.18
70 0.17
71 0.15
72 0.13
73 0.14
74 0.12
75 0.11
76 0.11
77 0.13
78 0.13
79 0.14
80 0.18
81 0.18
82 0.23
83 0.24
84 0.3
85 0.35
86 0.37
87 0.39
88 0.37
89 0.38
90 0.34
91 0.34
92 0.3
93 0.29
94 0.33
95 0.32
96 0.3
97 0.28
98 0.27
99 0.26
100 0.24
101 0.19
102 0.12
103 0.11
104 0.11
105 0.1
106 0.09
107 0.09
108 0.08
109 0.07
110 0.07
111 0.09
112 0.09
113 0.1
114 0.09
115 0.08
116 0.08
117 0.08
118 0.09
119 0.07
120 0.06
121 0.05
122 0.05
123 0.05
124 0.05
125 0.05
126 0.03
127 0.04
128 0.04
129 0.04
130 0.04
131 0.09
132 0.1
133 0.12
134 0.13
135 0.13
136 0.14
137 0.17
138 0.23
139 0.24
140 0.27
141 0.33
142 0.4
143 0.47
144 0.49
145 0.53
146 0.53
147 0.51
148 0.53
149 0.48
150 0.43
151 0.38
152 0.37
153 0.33
154 0.31
155 0.29
156 0.26
157 0.25
158 0.22
159 0.21
160 0.24
161 0.28
162 0.28
163 0.29
164 0.32
165 0.4
166 0.43
167 0.45
168 0.47
169 0.51
170 0.57
171 0.59
172 0.6
173 0.56
174 0.57
175 0.56
176 0.51
177 0.47
178 0.4
179 0.39
180 0.36
181 0.37
182 0.4
183 0.39
184 0.36
185 0.29
186 0.29
187 0.29
188 0.28
189 0.29
190 0.25
191 0.27
192 0.32
193 0.32
194 0.32
195 0.32
196 0.3
197 0.25
198 0.24
199 0.24
200 0.18
201 0.19
202 0.17
203 0.14
204 0.13
205 0.11
206 0.09
207 0.06
208 0.06
209 0.06
210 0.06
211 0.06
212 0.07
213 0.06
214 0.06
215 0.06
216 0.06
217 0.06
218 0.06
219 0.06
220 0.07
221 0.07
222 0.07
223 0.06
224 0.08
225 0.09
226 0.09
227 0.1
228 0.1
229 0.11
230 0.12
231 0.17
232 0.2
233 0.22
234 0.22
235 0.23
236 0.24
237 0.29
238 0.33
239 0.3
240 0.29
241 0.29
242 0.35
243 0.37
244 0.37
245 0.33
246 0.31
247 0.37
248 0.34
249 0.33
250 0.31
251 0.27
252 0.3
253 0.34
254 0.4
255 0.41
256 0.43
257 0.47
258 0.5
259 0.58
260 0.62
261 0.67
262 0.68
263 0.66
264 0.73
265 0.72
266 0.75
267 0.77
268 0.71
269 0.66
270 0.6
271 0.53
272 0.46
273 0.43
274 0.34
275 0.28
276 0.25
277 0.21
278 0.21
279 0.22
280 0.24
281 0.29
282 0.29
283 0.35