Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q2UPF9

Protein Details
Accession Q2UPF9    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
132-153SDCKRAWEENRERRKKKWEAWRBasic
NLS Segment(s)
PositionSequence
142-152RERRKKKWEAW
Subcellular Location(s) cyto 16.5, cyto_nucl 12.5, nucl 7.5
Family & Domain DBs
Amino Acid Sequences MSDDAPYEEEINKLVAEHGAVPPPYVTFPDIHPFEISWRIGSGESYLMMYSAWSAKEGMGEAQWIEYFRKFPPPPIWLTWAIDCIWSVAEKVEENIGENSDDDHDEFNLDPLEFDYWCYFRRTAALGFGTESDCKRAWEENRERRKKKWEAWR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.09
3 0.09
4 0.11
5 0.12
6 0.15
7 0.15
8 0.15
9 0.15
10 0.16
11 0.16
12 0.15
13 0.15
14 0.11
15 0.14
16 0.21
17 0.23
18 0.23
19 0.23
20 0.21
21 0.23
22 0.27
23 0.24
24 0.17
25 0.16
26 0.16
27 0.15
28 0.15
29 0.14
30 0.09
31 0.09
32 0.09
33 0.08
34 0.07
35 0.07
36 0.06
37 0.06
38 0.06
39 0.06
40 0.06
41 0.07
42 0.07
43 0.08
44 0.08
45 0.08
46 0.06
47 0.07
48 0.06
49 0.06
50 0.06
51 0.07
52 0.08
53 0.08
54 0.09
55 0.09
56 0.19
57 0.19
58 0.22
59 0.27
60 0.29
61 0.31
62 0.32
63 0.36
64 0.28
65 0.29
66 0.26
67 0.21
68 0.19
69 0.15
70 0.13
71 0.09
72 0.08
73 0.06
74 0.06
75 0.05
76 0.06
77 0.06
78 0.06
79 0.07
80 0.07
81 0.09
82 0.09
83 0.09
84 0.09
85 0.09
86 0.09
87 0.09
88 0.09
89 0.08
90 0.08
91 0.08
92 0.08
93 0.08
94 0.09
95 0.09
96 0.08
97 0.08
98 0.08
99 0.09
100 0.08
101 0.1
102 0.12
103 0.12
104 0.14
105 0.17
106 0.17
107 0.16
108 0.19
109 0.2
110 0.19
111 0.23
112 0.23
113 0.2
114 0.21
115 0.21
116 0.21
117 0.2
118 0.2
119 0.18
120 0.17
121 0.18
122 0.2
123 0.27
124 0.31
125 0.4
126 0.5
127 0.57
128 0.67
129 0.77
130 0.79
131 0.8
132 0.84
133 0.83