Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T6ZTK7

Protein Details
Accession A0A2T6ZTK7    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
77-113KVPKADKVPKGKKPPKEKKAGASPRKKRKTGKEAEAEBasic
NLS Segment(s)
PositionSequence
71-108AKAPREKVPKADKVPKGKKPPKEKKAGASPRKKRKTGK
Subcellular Location(s) nucl 13, cyto 10, mito 3
Family & Domain DBs
Amino Acid Sequences MPPASEEVLFLISCVRNTGDGKPNWKAVCDERGIVSTNAATKRWYRLSNANPVSAAAASSTSGAAEEEAPAKAPREKVPKADKVPKGKKPPKEKKAGASPRKKRKTGKEAEAEVEKPQPTSTSTVEGENESMEETMETNGAEVTEGSSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.16
4 0.18
5 0.25
6 0.3
7 0.33
8 0.39
9 0.41
10 0.47
11 0.44
12 0.43
13 0.4
14 0.36
15 0.38
16 0.34
17 0.31
18 0.26
19 0.28
20 0.29
21 0.25
22 0.21
23 0.16
24 0.19
25 0.19
26 0.18
27 0.18
28 0.18
29 0.24
30 0.29
31 0.29
32 0.29
33 0.36
34 0.41
35 0.5
36 0.5
37 0.44
38 0.39
39 0.37
40 0.33
41 0.24
42 0.19
43 0.08
44 0.06
45 0.05
46 0.06
47 0.05
48 0.04
49 0.04
50 0.04
51 0.04
52 0.04
53 0.05
54 0.05
55 0.05
56 0.07
57 0.07
58 0.08
59 0.1
60 0.12
61 0.16
62 0.23
63 0.25
64 0.32
65 0.39
66 0.45
67 0.5
68 0.58
69 0.59
70 0.62
71 0.69
72 0.7
73 0.74
74 0.73
75 0.75
76 0.77
77 0.82
78 0.8
79 0.81
80 0.77
81 0.74
82 0.78
83 0.8
84 0.78
85 0.78
86 0.8
87 0.81
88 0.86
89 0.85
90 0.82
91 0.82
92 0.83
93 0.82
94 0.81
95 0.79
96 0.74
97 0.71
98 0.66
99 0.57
100 0.48
101 0.42
102 0.33
103 0.25
104 0.22
105 0.19
106 0.17
107 0.2
108 0.2
109 0.21
110 0.21
111 0.23
112 0.24
113 0.24
114 0.22
115 0.18
116 0.16
117 0.12
118 0.11
119 0.09
120 0.08
121 0.07
122 0.08
123 0.08
124 0.07
125 0.07
126 0.07
127 0.06
128 0.07
129 0.06