Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T6ZXZ3

Protein Details
Accession A0A2T6ZXZ3    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
49-69VKPTPPKPSGSRKRHRQIPMPBasic
NLS Segment(s)
PositionSequence
53-64PPKPSGSRKRHR
Subcellular Location(s) nucl 22.5, cyto_nucl 13.333, mito_nucl 13.166
Family & Domain DBs
Amino Acid Sequences MSSKEKPGSPTPPPSREPKDENEDDEEEINLMKTFMSGEKTFYSPLPPVKPTPPKPSGSRKRHRQIPMPAELMVPNSRRTPWKAPKHPDSLPCTLKRQNPNYWWSAVTPEHRIPPVLNENESGNNSRLGNLSQGRLGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.67
3 0.66
4 0.65
5 0.61
6 0.62
7 0.59
8 0.59
9 0.56
10 0.5
11 0.44
12 0.38
13 0.31
14 0.22
15 0.19
16 0.15
17 0.09
18 0.07
19 0.06
20 0.05
21 0.06
22 0.07
23 0.12
24 0.12
25 0.14
26 0.16
27 0.17
28 0.19
29 0.18
30 0.19
31 0.18
32 0.22
33 0.24
34 0.24
35 0.26
36 0.33
37 0.42
38 0.45
39 0.51
40 0.51
41 0.51
42 0.55
43 0.63
44 0.66
45 0.67
46 0.71
47 0.72
48 0.76
49 0.81
50 0.8
51 0.78
52 0.76
53 0.72
54 0.67
55 0.59
56 0.5
57 0.42
58 0.36
59 0.3
60 0.23
61 0.18
62 0.15
63 0.14
64 0.15
65 0.18
66 0.23
67 0.31
68 0.38
69 0.48
70 0.56
71 0.63
72 0.69
73 0.73
74 0.72
75 0.69
76 0.65
77 0.61
78 0.58
79 0.53
80 0.52
81 0.51
82 0.54
83 0.56
84 0.56
85 0.57
86 0.57
87 0.59
88 0.56
89 0.52
90 0.46
91 0.37
92 0.36
93 0.31
94 0.29
95 0.3
96 0.3
97 0.32
98 0.31
99 0.32
100 0.28
101 0.31
102 0.36
103 0.33
104 0.32
105 0.29
106 0.31
107 0.34
108 0.36
109 0.32
110 0.25
111 0.24
112 0.23
113 0.23
114 0.23
115 0.2
116 0.24
117 0.24
118 0.25