Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T6ZTM4

Protein Details
Accession A0A2T6ZTM4    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
71-95VGYRRRWWLWRGHCRRRWLRKRRLWBasic
NLS Segment(s)
PositionSequence
85-93RRRWLRKRR
Subcellular Location(s) mito 10, plas 6, cyto_mito 6, extr 5, mito_nucl 5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MKKRYSSRVSRRGRMMAVVSLGGTTGGGGAGRREDASVGFRGRGGIATLALVLVLGVGLKEQGLMVTGFWVGYRRRWWLWRGHCRRRWLRKRRLW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.53
3 0.45
4 0.37
5 0.3
6 0.22
7 0.16
8 0.15
9 0.1
10 0.07
11 0.05
12 0.03
13 0.03
14 0.03
15 0.04
16 0.04
17 0.05
18 0.06
19 0.06
20 0.06
21 0.06
22 0.07
23 0.1
24 0.12
25 0.12
26 0.12
27 0.12
28 0.12
29 0.12
30 0.11
31 0.09
32 0.06
33 0.05
34 0.05
35 0.05
36 0.04
37 0.04
38 0.03
39 0.02
40 0.02
41 0.02
42 0.02
43 0.01
44 0.02
45 0.02
46 0.02
47 0.02
48 0.02
49 0.02
50 0.03
51 0.04
52 0.04
53 0.05
54 0.05
55 0.05
56 0.05
57 0.09
58 0.09
59 0.13
60 0.17
61 0.22
62 0.26
63 0.31
64 0.35
65 0.42
66 0.52
67 0.59
68 0.67
69 0.73
70 0.75
71 0.81
72 0.88
73 0.89
74 0.89
75 0.89