Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T6ZRG4

Protein Details
Accession A0A2T6ZRG4    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
90-130TYNPSHRVRKRRLGFLARKRTPGGRGVLKRRRLKGRKSLTHBasic
NLS Segment(s)
PositionSequence
96-127RVRKRRLGFLARKRTPGGRGVLKRRRLKGRKS
Subcellular Location(s) mito 18, nucl 4.5, cyto_nucl 4, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MFRTPSPFFLLHRSTQRPPCTPIPRLTRTIVTKITPLRPSTISFTPMGLTPPARAAVGGTGLGVTARLMPKISANPGLVGLQVRCGPRDTYNPSHRVRKRRLGFLARKRTPGGRGVLKRRRLKGRKSLTH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.58
3 0.63
4 0.59
5 0.61
6 0.64
7 0.64
8 0.62
9 0.63
10 0.63
11 0.61
12 0.61
13 0.58
14 0.55
15 0.51
16 0.52
17 0.47
18 0.39
19 0.39
20 0.4
21 0.43
22 0.4
23 0.37
24 0.35
25 0.33
26 0.34
27 0.34
28 0.31
29 0.28
30 0.24
31 0.23
32 0.2
33 0.19
34 0.18
35 0.13
36 0.12
37 0.09
38 0.1
39 0.1
40 0.09
41 0.09
42 0.08
43 0.07
44 0.07
45 0.06
46 0.05
47 0.04
48 0.04
49 0.04
50 0.04
51 0.03
52 0.04
53 0.05
54 0.05
55 0.05
56 0.06
57 0.08
58 0.09
59 0.11
60 0.13
61 0.13
62 0.13
63 0.13
64 0.13
65 0.12
66 0.12
67 0.1
68 0.08
69 0.12
70 0.12
71 0.12
72 0.13
73 0.15
74 0.17
75 0.24
76 0.3
77 0.36
78 0.43
79 0.49
80 0.52
81 0.61
82 0.65
83 0.68
84 0.69
85 0.71
86 0.7
87 0.72
88 0.76
89 0.77
90 0.8
91 0.81
92 0.84
93 0.77
94 0.75
95 0.69
96 0.64
97 0.57
98 0.53
99 0.5
100 0.48
101 0.53
102 0.6
103 0.66
104 0.72
105 0.77
106 0.8
107 0.83
108 0.82
109 0.83
110 0.83