Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T6ZDS0

Protein Details
Accession A0A2T6ZDS0   
Localization Confidence High
Confidence Score 15.6
NoLS Segment(s)
PositionSequenceProtein Nature
57-91VSQTHRCKQNKNSKEKLTFRKCTHETKEKKRKKKVBasic
NLS Segment(s)
PositionSequence
83-91KEKKRKKKV
Subcellular Location(s) nucl 19, mito 6
Family & Domain DBs
Amino Acid Sequences MPSVRCLPVIRREGMNSQDTHVPPRPVIILHHSFTSKILRRNDRGQINIPYSDAKPVSQTHRCKQNKNSKEKLTFRKCTHETKEKKRKKKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.44
3 0.35
4 0.32
5 0.36
6 0.33
7 0.36
8 0.37
9 0.33
10 0.28
11 0.29
12 0.28
13 0.22
14 0.23
15 0.24
16 0.23
17 0.23
18 0.25
19 0.23
20 0.23
21 0.23
22 0.29
23 0.26
24 0.28
25 0.35
26 0.4
27 0.44
28 0.49
29 0.55
30 0.51
31 0.5
32 0.47
33 0.44
34 0.4
35 0.36
36 0.31
37 0.25
38 0.22
39 0.22
40 0.18
41 0.13
42 0.14
43 0.16
44 0.23
45 0.29
46 0.36
47 0.39
48 0.5
49 0.55
50 0.59
51 0.67
52 0.71
53 0.72
54 0.75
55 0.78
56 0.77
57 0.82
58 0.84
59 0.85
60 0.83
61 0.83
62 0.78
63 0.78
64 0.74
65 0.74
66 0.73
67 0.73
68 0.73
69 0.76
70 0.83
71 0.83