Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T7A1I1

Protein Details
Accession A0A2T7A1I1    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
246-271EPYFSRIKFDKEQKKKWFRDREGLLFHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 18, E.R. 5, mito 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF07264  EI24  
Amino Acid Sequences MSNFDPNAVIRGAQLTVVGAYRALQNPSLFEMSHYRQAFFAVVIGVALRLLISAPIFGMKILISFIGLFTDLSAVTWDDDIISGLEFLEKSVLQVPVFLMSAMRYLVPTLDDMFMQSLEWVDKTYLIKHADESPHGLRALYYPNLRMYSRKASGAGALGTFEALKPFLIRYARRAGISIAVYFASFLPVVGQFVLPAASFYSFNRAAGPVPAAVVFGVGWLLPKRWMIVFLQGYFASRGLMRELLEPYFSRIKFDKEQKKKWFRDREGLLFGFGVGFYLLLQTPWLGVLIYGIAEASTAASKGFAETQVVWKNKHEFMKLDLDKLDRLNVKSAVKGAESPFVSSIAGKKSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.09
3 0.1
4 0.1
5 0.1
6 0.08
7 0.08
8 0.13
9 0.16
10 0.17
11 0.2
12 0.2
13 0.21
14 0.26
15 0.27
16 0.22
17 0.21
18 0.27
19 0.28
20 0.36
21 0.35
22 0.32
23 0.3
24 0.31
25 0.3
26 0.22
27 0.19
28 0.1
29 0.09
30 0.08
31 0.08
32 0.07
33 0.05
34 0.05
35 0.04
36 0.03
37 0.03
38 0.04
39 0.04
40 0.04
41 0.05
42 0.06
43 0.06
44 0.06
45 0.07
46 0.06
47 0.06
48 0.06
49 0.06
50 0.06
51 0.06
52 0.06
53 0.06
54 0.06
55 0.06
56 0.05
57 0.06
58 0.06
59 0.06
60 0.07
61 0.07
62 0.07
63 0.07
64 0.07
65 0.06
66 0.06
67 0.07
68 0.06
69 0.06
70 0.05
71 0.05
72 0.06
73 0.06
74 0.06
75 0.07
76 0.06
77 0.07
78 0.11
79 0.13
80 0.11
81 0.12
82 0.12
83 0.12
84 0.13
85 0.12
86 0.08
87 0.07
88 0.08
89 0.07
90 0.07
91 0.06
92 0.06
93 0.06
94 0.06
95 0.07
96 0.08
97 0.08
98 0.08
99 0.08
100 0.09
101 0.08
102 0.08
103 0.07
104 0.06
105 0.06
106 0.06
107 0.06
108 0.06
109 0.09
110 0.1
111 0.11
112 0.16
113 0.18
114 0.18
115 0.19
116 0.24
117 0.23
118 0.24
119 0.27
120 0.23
121 0.23
122 0.23
123 0.21
124 0.16
125 0.16
126 0.19
127 0.17
128 0.17
129 0.16
130 0.18
131 0.21
132 0.21
133 0.21
134 0.22
135 0.26
136 0.27
137 0.26
138 0.25
139 0.23
140 0.23
141 0.23
142 0.18
143 0.11
144 0.09
145 0.08
146 0.07
147 0.07
148 0.05
149 0.04
150 0.04
151 0.04
152 0.04
153 0.04
154 0.08
155 0.12
156 0.12
157 0.16
158 0.22
159 0.24
160 0.23
161 0.24
162 0.21
163 0.21
164 0.21
165 0.17
166 0.11
167 0.1
168 0.09
169 0.09
170 0.08
171 0.06
172 0.05
173 0.05
174 0.05
175 0.05
176 0.06
177 0.06
178 0.06
179 0.04
180 0.05
181 0.05
182 0.04
183 0.04
184 0.04
185 0.05
186 0.06
187 0.06
188 0.12
189 0.12
190 0.12
191 0.13
192 0.13
193 0.12
194 0.13
195 0.14
196 0.08
197 0.08
198 0.08
199 0.07
200 0.06
201 0.06
202 0.05
203 0.04
204 0.04
205 0.03
206 0.04
207 0.05
208 0.06
209 0.07
210 0.07
211 0.09
212 0.09
213 0.11
214 0.1
215 0.18
216 0.2
217 0.19
218 0.21
219 0.2
220 0.21
221 0.2
222 0.19
223 0.12
224 0.1
225 0.1
226 0.09
227 0.11
228 0.11
229 0.12
230 0.14
231 0.14
232 0.15
233 0.15
234 0.18
235 0.23
236 0.22
237 0.24
238 0.24
239 0.29
240 0.36
241 0.46
242 0.52
243 0.56
244 0.66
245 0.73
246 0.82
247 0.86
248 0.88
249 0.89
250 0.84
251 0.84
252 0.81
253 0.77
254 0.73
255 0.64
256 0.54
257 0.43
258 0.36
259 0.26
260 0.19
261 0.12
262 0.05
263 0.05
264 0.04
265 0.05
266 0.05
267 0.05
268 0.05
269 0.05
270 0.05
271 0.06
272 0.06
273 0.04
274 0.04
275 0.05
276 0.05
277 0.05
278 0.04
279 0.04
280 0.04
281 0.04
282 0.04
283 0.04
284 0.05
285 0.05
286 0.05
287 0.05
288 0.06
289 0.07
290 0.09
291 0.09
292 0.11
293 0.13
294 0.21
295 0.29
296 0.32
297 0.33
298 0.36
299 0.41
300 0.44
301 0.49
302 0.45
303 0.39
304 0.41
305 0.5
306 0.47
307 0.45
308 0.42
309 0.39
310 0.38
311 0.37
312 0.39
313 0.33
314 0.33
315 0.35
316 0.37
317 0.37
318 0.36
319 0.38
320 0.34
321 0.3
322 0.33
323 0.29
324 0.31
325 0.3
326 0.3
327 0.28
328 0.26
329 0.25
330 0.22
331 0.24