Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T6ZHT6

Protein Details
Accession A0A2T6ZHT6    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
129-156TVLEKEDADKKKRKKKLKDTQAIKLDDKBasic
NLS Segment(s)
PositionSequence
138-146KKKRKKKLK
Subcellular Location(s) cyto 13.5, cyto_nucl 11.5, nucl 8.5, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR006195  aa-tRNA-synth_II  
IPR045864  aa-tRNA-synth_II/BPL/LPL  
IPR004154  Anticodon-bd  
IPR036621  Anticodon-bd_dom_sf  
IPR027031  Gly-tRNA_synthase/POLG2  
IPR033731  GlyRS-like_core  
IPR002315  tRNA-synt_gly  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005524  F:ATP binding  
GO:0004820  F:glycine-tRNA ligase activity  
GO:0006426  P:glycyl-tRNA aminoacylation  
Pfam View protein in Pfam  
PF03129  HGTP_anticodon  
PROSITE View protein in PROSITE  
PS50862  AA_TRNA_LIGASE_II  
CDD cd00774  GlyRS-like_core  
cd00858  GlyRS_anticodon  
Amino Acid Sequences MTTTTTKTGDPLDRGTLDTLLRKRLFYAPAFEIYGGVSGLYDYGPPGCSLQANIVDAWRRHFVLEEDMLEVDCAMLTPHDVLKTSGHVDKFADWMCKDPKTGEIFRADHIIEEILEARLKCDKEARGATVLEKEDADKKKRKKKLKDTQAIKLDDKVIQEYQDILAKIDNYSGEELGKLIVDHGITSPTTGNPLEPPVLFNLMFQTSIGPTTNHPGYLRPETAQGQFLIFNRLYEFNNLRTPFASASIGKSFRNEISPRSGLLRVREFLMAEIEHFVDPLDKKHPRFPEVADKVSLRFLPRAIQAEGKTTTVEKTIGEVVEEGMVDNETLGYFLARIHLFLKELGIDPEKVRFRQHMPNEMAHYAADCWDAELLTSYGWIECVGCADRSAYDLTVHSNKTGRQLVVRETLEPPKVWEEWDMDVDKKWLGPKFRKDAKKIEDAVARISQEDRERLAALQVAGGKVFVEVEGLGSVELEKVTIEKNEKSVNVREYTPNVIEPSFGIGRILYSLIEHIYWSRPGDEARGVLSFPPKIAPIKILIVPLSNHPCFAPIVTALSAKIRRAGISKRVDDSSASIGKRYARNDELGTPFGITVDFQSLEDGTITLRERDGMKQVRGTQDEVIEIVRGILGGHSTFDDALAKFGEFQGQELDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.36
3 0.32
4 0.29
5 0.33
6 0.33
7 0.36
8 0.37
9 0.36
10 0.37
11 0.41
12 0.44
13 0.4
14 0.43
15 0.37
16 0.39
17 0.4
18 0.37
19 0.3
20 0.25
21 0.22
22 0.16
23 0.11
24 0.07
25 0.06
26 0.06
27 0.06
28 0.06
29 0.06
30 0.07
31 0.08
32 0.09
33 0.1
34 0.11
35 0.12
36 0.12
37 0.17
38 0.19
39 0.2
40 0.2
41 0.22
42 0.28
43 0.28
44 0.31
45 0.3
46 0.27
47 0.26
48 0.27
49 0.25
50 0.26
51 0.29
52 0.26
53 0.23
54 0.23
55 0.23
56 0.2
57 0.18
58 0.11
59 0.07
60 0.06
61 0.04
62 0.04
63 0.05
64 0.07
65 0.09
66 0.1
67 0.12
68 0.13
69 0.15
70 0.18
71 0.21
72 0.24
73 0.23
74 0.23
75 0.24
76 0.24
77 0.27
78 0.26
79 0.28
80 0.24
81 0.29
82 0.33
83 0.33
84 0.33
85 0.3
86 0.34
87 0.35
88 0.38
89 0.36
90 0.39
91 0.39
92 0.38
93 0.41
94 0.35
95 0.27
96 0.25
97 0.21
98 0.13
99 0.13
100 0.13
101 0.09
102 0.12
103 0.11
104 0.12
105 0.17
106 0.17
107 0.18
108 0.24
109 0.25
110 0.31
111 0.35
112 0.37
113 0.35
114 0.35
115 0.36
116 0.35
117 0.34
118 0.27
119 0.23
120 0.21
121 0.26
122 0.32
123 0.38
124 0.42
125 0.5
126 0.6
127 0.69
128 0.77
129 0.81
130 0.85
131 0.88
132 0.91
133 0.91
134 0.88
135 0.89
136 0.87
137 0.81
138 0.71
139 0.62
140 0.53
141 0.45
142 0.39
143 0.33
144 0.25
145 0.21
146 0.2
147 0.18
148 0.17
149 0.18
150 0.17
151 0.14
152 0.14
153 0.14
154 0.13
155 0.14
156 0.13
157 0.11
158 0.12
159 0.12
160 0.1
161 0.1
162 0.1
163 0.08
164 0.08
165 0.06
166 0.05
167 0.06
168 0.06
169 0.06
170 0.07
171 0.08
172 0.07
173 0.08
174 0.09
175 0.08
176 0.11
177 0.11
178 0.11
179 0.11
180 0.13
181 0.14
182 0.13
183 0.14
184 0.13
185 0.16
186 0.15
187 0.14
188 0.14
189 0.13
190 0.13
191 0.12
192 0.11
193 0.09
194 0.1
195 0.11
196 0.09
197 0.09
198 0.15
199 0.15
200 0.16
201 0.16
202 0.17
203 0.22
204 0.26
205 0.27
206 0.22
207 0.25
208 0.26
209 0.27
210 0.26
211 0.22
212 0.17
213 0.18
214 0.18
215 0.19
216 0.16
217 0.15
218 0.15
219 0.17
220 0.17
221 0.19
222 0.21
223 0.19
224 0.26
225 0.27
226 0.26
227 0.24
228 0.25
229 0.2
230 0.2
231 0.19
232 0.13
233 0.16
234 0.19
235 0.21
236 0.19
237 0.2
238 0.2
239 0.19
240 0.25
241 0.22
242 0.2
243 0.26
244 0.26
245 0.26
246 0.27
247 0.29
248 0.25
249 0.28
250 0.29
251 0.23
252 0.23
253 0.23
254 0.2
255 0.17
256 0.17
257 0.13
258 0.09
259 0.1
260 0.09
261 0.08
262 0.08
263 0.08
264 0.08
265 0.09
266 0.11
267 0.17
268 0.21
269 0.23
270 0.29
271 0.33
272 0.34
273 0.35
274 0.37
275 0.41
276 0.41
277 0.41
278 0.37
279 0.33
280 0.31
281 0.3
282 0.28
283 0.18
284 0.14
285 0.13
286 0.14
287 0.16
288 0.18
289 0.18
290 0.21
291 0.2
292 0.23
293 0.23
294 0.21
295 0.18
296 0.16
297 0.15
298 0.12
299 0.12
300 0.08
301 0.09
302 0.1
303 0.09
304 0.09
305 0.08
306 0.07
307 0.07
308 0.07
309 0.05
310 0.04
311 0.04
312 0.04
313 0.03
314 0.03
315 0.03
316 0.03
317 0.03
318 0.03
319 0.03
320 0.03
321 0.06
322 0.06
323 0.07
324 0.07
325 0.08
326 0.09
327 0.09
328 0.09
329 0.07
330 0.08
331 0.09
332 0.09
333 0.1
334 0.1
335 0.16
336 0.18
337 0.18
338 0.19
339 0.2
340 0.23
341 0.31
342 0.35
343 0.38
344 0.39
345 0.42
346 0.43
347 0.4
348 0.36
349 0.27
350 0.23
351 0.14
352 0.11
353 0.09
354 0.06
355 0.06
356 0.05
357 0.05
358 0.05
359 0.06
360 0.05
361 0.04
362 0.05
363 0.05
364 0.04
365 0.05
366 0.05
367 0.04
368 0.03
369 0.05
370 0.06
371 0.06
372 0.07
373 0.07
374 0.07
375 0.08
376 0.09
377 0.08
378 0.08
379 0.08
380 0.11
381 0.15
382 0.15
383 0.16
384 0.17
385 0.17
386 0.22
387 0.26
388 0.23
389 0.22
390 0.24
391 0.26
392 0.32
393 0.31
394 0.27
395 0.27
396 0.3
397 0.29
398 0.27
399 0.25
400 0.21
401 0.2
402 0.19
403 0.18
404 0.17
405 0.17
406 0.2
407 0.19
408 0.17
409 0.17
410 0.18
411 0.16
412 0.14
413 0.17
414 0.17
415 0.23
416 0.31
417 0.39
418 0.48
419 0.57
420 0.63
421 0.65
422 0.71
423 0.69
424 0.69
425 0.64
426 0.6
427 0.55
428 0.47
429 0.46
430 0.38
431 0.33
432 0.25
433 0.23
434 0.21
435 0.19
436 0.2
437 0.18
438 0.17
439 0.18
440 0.17
441 0.18
442 0.16
443 0.13
444 0.13
445 0.13
446 0.12
447 0.11
448 0.1
449 0.09
450 0.07
451 0.07
452 0.05
453 0.04
454 0.04
455 0.04
456 0.05
457 0.05
458 0.04
459 0.04
460 0.05
461 0.04
462 0.04
463 0.04
464 0.04
465 0.04
466 0.06
467 0.1
468 0.13
469 0.14
470 0.18
471 0.21
472 0.24
473 0.28
474 0.32
475 0.34
476 0.33
477 0.34
478 0.35
479 0.34
480 0.36
481 0.33
482 0.29
483 0.26
484 0.23
485 0.21
486 0.18
487 0.2
488 0.16
489 0.14
490 0.12
491 0.1
492 0.11
493 0.11
494 0.11
495 0.06
496 0.06
497 0.07
498 0.07
499 0.08
500 0.08
501 0.09
502 0.11
503 0.13
504 0.14
505 0.14
506 0.15
507 0.15
508 0.18
509 0.19
510 0.17
511 0.17
512 0.17
513 0.16
514 0.17
515 0.2
516 0.17
517 0.15
518 0.16
519 0.16
520 0.18
521 0.19
522 0.19
523 0.18
524 0.21
525 0.23
526 0.23
527 0.22
528 0.21
529 0.21
530 0.26
531 0.31
532 0.27
533 0.26
534 0.24
535 0.24
536 0.23
537 0.22
538 0.18
539 0.11
540 0.14
541 0.14
542 0.15
543 0.14
544 0.2
545 0.22
546 0.21
547 0.25
548 0.23
549 0.24
550 0.29
551 0.35
552 0.38
553 0.44
554 0.48
555 0.47
556 0.48
557 0.47
558 0.43
559 0.39
560 0.37
561 0.34
562 0.3
563 0.27
564 0.28
565 0.33
566 0.37
567 0.37
568 0.38
569 0.35
570 0.39
571 0.41
572 0.45
573 0.44
574 0.4
575 0.37
576 0.3
577 0.26
578 0.22
579 0.19
580 0.13
581 0.1
582 0.12
583 0.12
584 0.11
585 0.13
586 0.13
587 0.13
588 0.13
589 0.11
590 0.08
591 0.11
592 0.13
593 0.13
594 0.13
595 0.15
596 0.17
597 0.2
598 0.3
599 0.34
600 0.36
601 0.42
602 0.47
603 0.53
604 0.54
605 0.53
606 0.47
607 0.41
608 0.38
609 0.31
610 0.26
611 0.19
612 0.15
613 0.13
614 0.09
615 0.07
616 0.07
617 0.06
618 0.07
619 0.07
620 0.08
621 0.09
622 0.1
623 0.1
624 0.11
625 0.14
626 0.12
627 0.14
628 0.14
629 0.14
630 0.13
631 0.14
632 0.19
633 0.16
634 0.16