Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q2UTE8

Protein Details
Accession Q2UTE8   
Localization Confidence Low
Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
9-39AQPAPSKKVRLACRRCRAKRVKASNPQPISKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, cyto_nucl 12, mito 5, cyto 4
Family & Domain DBs
Amino Acid Sequences MAPTEAEAAQPAPSKKVRLACRRCRAKRVKASNPQPISKDENYLTTPANVLPTSVMEVFQPVGTALGQVSRVLMSMAGIMDYPSHETSSHGVMPGSTGLNKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.3
3 0.38
4 0.45
5 0.51
6 0.6
7 0.66
8 0.74
9 0.82
10 0.83
11 0.86
12 0.86
13 0.86
14 0.86
15 0.86
16 0.85
17 0.85
18 0.87
19 0.87
20 0.82
21 0.75
22 0.66
23 0.59
24 0.56
25 0.46
26 0.41
27 0.31
28 0.29
29 0.27
30 0.26
31 0.23
32 0.16
33 0.16
34 0.12
35 0.13
36 0.1
37 0.08
38 0.07
39 0.07
40 0.08
41 0.08
42 0.08
43 0.06
44 0.06
45 0.07
46 0.06
47 0.06
48 0.04
49 0.05
50 0.05
51 0.05
52 0.04
53 0.05
54 0.05
55 0.05
56 0.06
57 0.05
58 0.05
59 0.05
60 0.05
61 0.04
62 0.05
63 0.05
64 0.05
65 0.05
66 0.05
67 0.05
68 0.06
69 0.09
70 0.1
71 0.11
72 0.11
73 0.13
74 0.15
75 0.19
76 0.19
77 0.17
78 0.16
79 0.15
80 0.16
81 0.16
82 0.17