Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T6ZSH2

Protein Details
Accession A0A2T6ZSH2   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
45-70SKIPVRTATLRKSRRPRPNSASPAKPHydrophilic
NLS Segment(s)
PositionSequence
55-63RKSRRPRPN
Subcellular Location(s) mito 21.5, cyto_mito 12.5, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MFNRHKKPRTGNTLPPSLISGPIQQTTAQMSFPASAPLPRTPSISKIPVRTATLRKSRRPRPNSASPAKPGYTPKSNTPTPVGSPKKNTTKSHSRFGLWSNASRTSMFQPAGVSDEPKTASTTWETAVSGGRGPLGPATASAGRFSWNSPSPASLALPPPMSDTYSAMAAEIMALKAENQMLSREIVAERKFSAMLVEVLKSFHECAGRVNPAPGDIGSVYYRELRDESGDPLVPMEYVTEGLAANGVDSEWEDETEVLGDSGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.62
3 0.56
4 0.46
5 0.4
6 0.31
7 0.29
8 0.24
9 0.25
10 0.25
11 0.21
12 0.21
13 0.24
14 0.23
15 0.18
16 0.15
17 0.15
18 0.15
19 0.15
20 0.17
21 0.13
22 0.14
23 0.18
24 0.21
25 0.25
26 0.25
27 0.29
28 0.28
29 0.32
30 0.37
31 0.41
32 0.41
33 0.42
34 0.46
35 0.46
36 0.48
37 0.5
38 0.5
39 0.52
40 0.57
41 0.6
42 0.64
43 0.7
44 0.76
45 0.8
46 0.8
47 0.81
48 0.8
49 0.83
50 0.83
51 0.81
52 0.77
53 0.7
54 0.69
55 0.59
56 0.54
57 0.49
58 0.45
59 0.45
60 0.42
61 0.45
62 0.46
63 0.46
64 0.45
65 0.44
66 0.4
67 0.36
68 0.43
69 0.42
70 0.4
71 0.45
72 0.5
73 0.56
74 0.61
75 0.61
76 0.59
77 0.64
78 0.64
79 0.66
80 0.62
81 0.53
82 0.48
83 0.47
84 0.48
85 0.39
86 0.38
87 0.32
88 0.31
89 0.31
90 0.29
91 0.28
92 0.22
93 0.24
94 0.2
95 0.18
96 0.15
97 0.15
98 0.17
99 0.16
100 0.14
101 0.1
102 0.12
103 0.12
104 0.12
105 0.13
106 0.1
107 0.11
108 0.12
109 0.12
110 0.11
111 0.11
112 0.11
113 0.1
114 0.1
115 0.1
116 0.08
117 0.07
118 0.07
119 0.06
120 0.06
121 0.05
122 0.05
123 0.04
124 0.04
125 0.07
126 0.08
127 0.08
128 0.09
129 0.09
130 0.1
131 0.1
132 0.11
133 0.13
134 0.14
135 0.16
136 0.16
137 0.16
138 0.16
139 0.16
140 0.17
141 0.14
142 0.13
143 0.13
144 0.13
145 0.12
146 0.14
147 0.14
148 0.13
149 0.12
150 0.12
151 0.11
152 0.11
153 0.11
154 0.09
155 0.08
156 0.07
157 0.06
158 0.05
159 0.04
160 0.04
161 0.04
162 0.04
163 0.05
164 0.06
165 0.06
166 0.06
167 0.07
168 0.09
169 0.09
170 0.09
171 0.1
172 0.1
173 0.15
174 0.15
175 0.16
176 0.16
177 0.16
178 0.16
179 0.15
180 0.15
181 0.11
182 0.12
183 0.12
184 0.12
185 0.11
186 0.12
187 0.12
188 0.12
189 0.11
190 0.12
191 0.12
192 0.12
193 0.15
194 0.21
195 0.26
196 0.25
197 0.27
198 0.25
199 0.23
200 0.24
201 0.2
202 0.17
203 0.12
204 0.14
205 0.13
206 0.13
207 0.14
208 0.16
209 0.16
210 0.15
211 0.16
212 0.15
213 0.18
214 0.19
215 0.21
216 0.22
217 0.23
218 0.21
219 0.2
220 0.19
221 0.15
222 0.13
223 0.11
224 0.07
225 0.07
226 0.07
227 0.07
228 0.07
229 0.07
230 0.08
231 0.07
232 0.06
233 0.06
234 0.05
235 0.05
236 0.06
237 0.08
238 0.08
239 0.09
240 0.1
241 0.1
242 0.1
243 0.11
244 0.1