Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T6ZUD9

Protein Details
Accession A0A2T6ZUD9    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
5-27LRYYLKSLRKIPKREFKFPRETSHydrophilic
NLS Segment(s)
PositionSequence
13-32RKIPKREFKFPRETSPLGRR
Subcellular Location(s) mito 10, plas 8, E.R. 5, mito_nucl 5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MIAALRYYLKSLRKIPKREFKFPRETSPLGRRPRSFAPERRCGMGGGGVRVLLLLPVVFFYFFFVRVQGWING
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.7
3 0.75
4 0.78
5 0.82
6 0.82
7 0.8
8 0.81
9 0.76
10 0.74
11 0.7
12 0.65
13 0.62
14 0.62
15 0.62
16 0.59
17 0.61
18 0.54
19 0.51
20 0.54
21 0.53
22 0.51
23 0.51
24 0.51
25 0.54
26 0.54
27 0.52
28 0.47
29 0.41
30 0.34
31 0.3
32 0.24
33 0.17
34 0.16
35 0.13
36 0.12
37 0.12
38 0.11
39 0.06
40 0.04
41 0.03
42 0.03
43 0.04
44 0.04
45 0.05
46 0.05
47 0.08
48 0.09
49 0.1
50 0.11
51 0.11
52 0.12
53 0.13