Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T6ZCQ5

Protein Details
Accession A0A2T6ZCQ5    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
67-93GGELQKVKKKRNQKKQKPKAAVKEDDLBasic
NLS Segment(s)
PositionSequence
72-86KVKKKRNQKKQKPKA
Subcellular Location(s) cyto 15.5, cyto_nucl 12.333, nucl 8, mito_nucl 6.333
Family & Domain DBs
Amino Acid Sequences MLKRKEQGESQKKIIALEERVIVLSKPISEREKRRTVLKKIVTGDEEKNIGPSGIEEVVIGGIIVAGGELQKVKKKRNQKKQKPKAAVKEDDLNEFGIFKRWKGTDADSQERNWTKEEWDLHAKM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.42
3 0.35
4 0.31
5 0.27
6 0.23
7 0.23
8 0.23
9 0.19
10 0.15
11 0.12
12 0.12
13 0.12
14 0.17
15 0.22
16 0.29
17 0.37
18 0.44
19 0.52
20 0.53
21 0.6
22 0.65
23 0.66
24 0.69
25 0.67
26 0.65
27 0.59
28 0.6
29 0.53
30 0.48
31 0.42
32 0.34
33 0.3
34 0.23
35 0.21
36 0.17
37 0.14
38 0.1
39 0.08
40 0.08
41 0.07
42 0.07
43 0.06
44 0.06
45 0.06
46 0.05
47 0.05
48 0.02
49 0.02
50 0.02
51 0.02
52 0.01
53 0.01
54 0.02
55 0.02
56 0.03
57 0.04
58 0.09
59 0.13
60 0.19
61 0.26
62 0.37
63 0.48
64 0.59
65 0.69
66 0.76
67 0.84
68 0.9
69 0.94
70 0.93
71 0.92
72 0.91
73 0.89
74 0.83
75 0.75
76 0.73
77 0.63
78 0.55
79 0.47
80 0.38
81 0.28
82 0.24
83 0.2
84 0.19
85 0.19
86 0.16
87 0.21
88 0.2
89 0.23
90 0.26
91 0.31
92 0.32
93 0.4
94 0.47
95 0.44
96 0.45
97 0.52
98 0.53
99 0.49
100 0.42
101 0.36
102 0.3
103 0.35
104 0.37
105 0.35