Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T6ZQ42

Protein Details
Accession A0A2T6ZQ42    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
68-94ISKGEFRGGKEKKKRNERIFKTLPQSIHydrophilic
NLS Segment(s)
PositionSequence
72-84EFRGGKEKKKRNE
Subcellular Location(s) mito 11, nucl 4.5, cyto_nucl 4, pero 3, cyto 2.5, plas 2, extr 2, E.R. 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences TPTSFSTLPVSHSYQSASPVHLLASHTLRLLYSPNFVVDSDFGIHLVVLFLSFLLPPLSARKVERYNISKGEFRGGKEKKKRNERIFKTLPQSIDRLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.26
3 0.24
4 0.21
5 0.18
6 0.18
7 0.17
8 0.16
9 0.16
10 0.15
11 0.16
12 0.15
13 0.14
14 0.14
15 0.14
16 0.13
17 0.14
18 0.12
19 0.12
20 0.11
21 0.12
22 0.12
23 0.13
24 0.13
25 0.1
26 0.11
27 0.09
28 0.09
29 0.08
30 0.07
31 0.07
32 0.06
33 0.05
34 0.04
35 0.03
36 0.02
37 0.02
38 0.03
39 0.03
40 0.03
41 0.03
42 0.04
43 0.04
44 0.08
45 0.1
46 0.11
47 0.13
48 0.19
49 0.22
50 0.26
51 0.33
52 0.34
53 0.38
54 0.42
55 0.44
56 0.41
57 0.38
58 0.43
59 0.37
60 0.35
61 0.41
62 0.42
63 0.49
64 0.56
65 0.64
66 0.67
67 0.75
68 0.84
69 0.85
70 0.9
71 0.87
72 0.88
73 0.86
74 0.84
75 0.81
76 0.75
77 0.68
78 0.6