Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T6ZYN0

Protein Details
Accession A0A2T6ZYN0    Localization Confidence High Confidence Score 18.3
NoLS Segment(s)
PositionSequenceProtein Nature
242-262VREHRKKERELIKQGKKPFYLBasic
279-310LNEKQLEKVIEKKRKRKSQKERKSVPFERRAGBasic
NLS Segment(s)
PositionSequence
122-147GIKPRKTREELKRSSKHAPQEVSSKR
209-310SKDERKKEQLKKELLSMESKRKAEKDKEQVENVVREHRKKERELIKQGKKPFYLKKAEQKKLLLVEKYSKLNEKQLEKVIEKKRKRKSQKERKSVPFERRAG
Subcellular Location(s) nucl 23.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR009292  RRP36  
Gene Ontology GO:0005730  C:nucleolus  
GO:1990904  C:ribonucleoprotein complex  
GO:0000469  P:cleavage involved in rRNA processing  
Pfam View protein in Pfam  
PF06102  RRP36  
Amino Acid Sequences MNFRRVKPLLNDDDSDERDQKNFMSDSLEFQGASEAEISGSDDGDMTGSDNELRDGDDDMDIEGEESNEEERSNAQDAISHISFGTLAKAQRSITKERQKSQSISKEDRGAATKATLKESQGIKPRKTREELKRSSKHAPQEVSSKRAVTRRREAIAPIIPAAQAARDPRFDTAVKGVYDEKAFKKNYSFLNDYREDEMKALKQEISKSKDERKKEQLKKELLSMESKRKAEKDKEQVENVVREHRKKERELIKQGKKPFYLKKAEQKKLLLVEKYSKLNEKQLEKVIEKKRKRKSQKERKSVPFERRAG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.51
3 0.45
4 0.37
5 0.34
6 0.33
7 0.29
8 0.28
9 0.25
10 0.2
11 0.23
12 0.22
13 0.25
14 0.28
15 0.28
16 0.22
17 0.21
18 0.23
19 0.17
20 0.17
21 0.13
22 0.09
23 0.08
24 0.09
25 0.1
26 0.07
27 0.07
28 0.07
29 0.06
30 0.06
31 0.06
32 0.06
33 0.06
34 0.06
35 0.06
36 0.07
37 0.08
38 0.09
39 0.08
40 0.09
41 0.09
42 0.1
43 0.11
44 0.1
45 0.1
46 0.1
47 0.1
48 0.09
49 0.08
50 0.07
51 0.06
52 0.05
53 0.06
54 0.06
55 0.06
56 0.06
57 0.06
58 0.07
59 0.1
60 0.13
61 0.13
62 0.12
63 0.14
64 0.15
65 0.22
66 0.21
67 0.18
68 0.15
69 0.15
70 0.15
71 0.13
72 0.14
73 0.1
74 0.11
75 0.12
76 0.14
77 0.14
78 0.2
79 0.24
80 0.3
81 0.37
82 0.46
83 0.52
84 0.56
85 0.63
86 0.63
87 0.63
88 0.65
89 0.64
90 0.62
91 0.61
92 0.58
93 0.55
94 0.51
95 0.49
96 0.42
97 0.34
98 0.27
99 0.23
100 0.25
101 0.21
102 0.24
103 0.22
104 0.2
105 0.25
106 0.27
107 0.3
108 0.35
109 0.4
110 0.41
111 0.47
112 0.52
113 0.52
114 0.55
115 0.59
116 0.6
117 0.64
118 0.69
119 0.72
120 0.72
121 0.71
122 0.72
123 0.68
124 0.63
125 0.58
126 0.51
127 0.43
128 0.47
129 0.44
130 0.41
131 0.38
132 0.32
133 0.3
134 0.33
135 0.38
136 0.35
137 0.4
138 0.42
139 0.43
140 0.42
141 0.41
142 0.4
143 0.36
144 0.3
145 0.23
146 0.18
147 0.15
148 0.14
149 0.13
150 0.08
151 0.07
152 0.08
153 0.09
154 0.1
155 0.11
156 0.12
157 0.15
158 0.16
159 0.15
160 0.16
161 0.18
162 0.17
163 0.18
164 0.18
165 0.16
166 0.17
167 0.19
168 0.19
169 0.21
170 0.23
171 0.22
172 0.24
173 0.28
174 0.31
175 0.35
176 0.36
177 0.32
178 0.38
179 0.39
180 0.39
181 0.37
182 0.33
183 0.27
184 0.23
185 0.24
186 0.19
187 0.19
188 0.18
189 0.17
190 0.18
191 0.23
192 0.3
193 0.33
194 0.36
195 0.4
196 0.49
197 0.54
198 0.58
199 0.6
200 0.63
201 0.69
202 0.72
203 0.77
204 0.77
205 0.77
206 0.73
207 0.7
208 0.64
209 0.55
210 0.53
211 0.48
212 0.48
213 0.48
214 0.47
215 0.45
216 0.45
217 0.51
218 0.52
219 0.57
220 0.58
221 0.6
222 0.65
223 0.64
224 0.65
225 0.61
226 0.57
227 0.49
228 0.48
229 0.44
230 0.42
231 0.46
232 0.5
233 0.52
234 0.52
235 0.6
236 0.6
237 0.65
238 0.72
239 0.77
240 0.78
241 0.79
242 0.83
243 0.81
244 0.76
245 0.73
246 0.71
247 0.7
248 0.69
249 0.7
250 0.72
251 0.76
252 0.78
253 0.77
254 0.72
255 0.69
256 0.68
257 0.66
258 0.59
259 0.53
260 0.53
261 0.51
262 0.53
263 0.51
264 0.49
265 0.45
266 0.5
267 0.52
268 0.5
269 0.51
270 0.53
271 0.57
272 0.54
273 0.6
274 0.62
275 0.66
276 0.7
277 0.74
278 0.77
279 0.81
280 0.89
281 0.91
282 0.92
283 0.93
284 0.94
285 0.96
286 0.95
287 0.95
288 0.94
289 0.92
290 0.91