Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T7A0L7

Protein Details
Accession A0A2T7A0L7   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
81-100NYQLKSSKKNDTKDKRFEKVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, extr 6, cyto_mito 6, plas 3
Family & Domain DBs
Amino Acid Sequences MRSSFRAAPFLRISAVIVMASVPKCLLGTVFCCALKVLVVIFSCKTGTVDQQNDPRLVLKNLSGYSYSGTRTWVPKTVTANYQLKSSKKNDTKDKRFEKVTTHFLVNKGESKHTQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.2
3 0.13
4 0.1
5 0.09
6 0.11
7 0.11
8 0.1
9 0.09
10 0.08
11 0.08
12 0.08
13 0.09
14 0.07
15 0.09
16 0.11
17 0.14
18 0.13
19 0.14
20 0.14
21 0.13
22 0.11
23 0.1
24 0.08
25 0.08
26 0.08
27 0.09
28 0.1
29 0.1
30 0.1
31 0.1
32 0.11
33 0.09
34 0.12
35 0.17
36 0.2
37 0.23
38 0.28
39 0.3
40 0.29
41 0.29
42 0.27
43 0.22
44 0.2
45 0.17
46 0.13
47 0.14
48 0.14
49 0.15
50 0.13
51 0.12
52 0.13
53 0.13
54 0.13
55 0.1
56 0.12
57 0.13
58 0.15
59 0.17
60 0.22
61 0.22
62 0.25
63 0.29
64 0.31
65 0.32
66 0.36
67 0.39
68 0.34
69 0.38
70 0.38
71 0.36
72 0.39
73 0.4
74 0.43
75 0.46
76 0.54
77 0.6
78 0.67
79 0.74
80 0.78
81 0.83
82 0.79
83 0.77
84 0.72
85 0.69
86 0.66
87 0.63
88 0.57
89 0.54
90 0.5
91 0.47
92 0.5
93 0.45
94 0.43
95 0.39