Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T6ZC38

Protein Details
Accession A0A2T6ZC38    Localization Confidence Low Confidence Score 5.8
NoLS Segment(s)
PositionSequenceProtein Nature
3-22TAARLVKKYFRRLEPRGRITHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21, cyto 3, nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR037151  AlkB-like_sf  
IPR032854  ALKBH3  
Gene Ontology GO:0051213  F:dioxygenase activity  
GO:0006307  P:DNA dealkylation involved in DNA repair  
GO:0035552  P:oxidative single-stranded DNA demethylation  
Amino Acid Sequences MLTAARLVKKYFRRLEPRGRITAGLVNCHSGPQQGVGFRTHALTYIGPRAIICPLSLGVTRQFRIQKQPPSSHSSGTYAIHLPHNSLLVMTTGCKRIGSSPFS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.78
3 0.8
4 0.79
5 0.75
6 0.69
7 0.6
8 0.52
9 0.5
10 0.4
11 0.33
12 0.27
13 0.24
14 0.22
15 0.22
16 0.2
17 0.15
18 0.14
19 0.12
20 0.13
21 0.13
22 0.14
23 0.15
24 0.15
25 0.15
26 0.15
27 0.13
28 0.11
29 0.11
30 0.1
31 0.11
32 0.13
33 0.13
34 0.12
35 0.12
36 0.12
37 0.11
38 0.11
39 0.09
40 0.06
41 0.06
42 0.08
43 0.08
44 0.08
45 0.12
46 0.15
47 0.15
48 0.19
49 0.22
50 0.23
51 0.32
52 0.39
53 0.43
54 0.48
55 0.54
56 0.54
57 0.58
58 0.58
59 0.52
60 0.46
61 0.41
62 0.36
63 0.3
64 0.28
65 0.22
66 0.21
67 0.23
68 0.22
69 0.2
70 0.19
71 0.19
72 0.16
73 0.14
74 0.13
75 0.1
76 0.1
77 0.11
78 0.13
79 0.15
80 0.16
81 0.16
82 0.17
83 0.22