Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T6ZNJ8

Protein Details
Accession A0A2T6ZNJ8    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MKRREEKKREKGRQKSQEELFLBasic
NLS Segment(s)
PositionSequence
2-14KRREEKKREKGRQ
Subcellular Location(s) mito 15, nucl 4.5, cyto_nucl 4.5, cyto 3.5, pero 2
Family & Domain DBs
Amino Acid Sequences MKRREEKKREKGRQKSQEELFLFFHSWRLWLWLCIRSRFCSHVLSHIPVLANLSGGRQTLFLQHLLQLISPSTKGASGTVRSDKILFIVTNAYQRTELRPYCTVLNCTQGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.88
3 0.81
4 0.79
5 0.7
6 0.62
7 0.53
8 0.45
9 0.38
10 0.3
11 0.28
12 0.18
13 0.17
14 0.13
15 0.16
16 0.14
17 0.16
18 0.19
19 0.23
20 0.26
21 0.31
22 0.33
23 0.32
24 0.34
25 0.34
26 0.33
27 0.31
28 0.29
29 0.31
30 0.31
31 0.3
32 0.28
33 0.26
34 0.24
35 0.2
36 0.2
37 0.12
38 0.1
39 0.07
40 0.07
41 0.06
42 0.06
43 0.06
44 0.06
45 0.06
46 0.08
47 0.09
48 0.1
49 0.1
50 0.11
51 0.12
52 0.11
53 0.11
54 0.09
55 0.08
56 0.08
57 0.08
58 0.07
59 0.06
60 0.07
61 0.07
62 0.08
63 0.11
64 0.13
65 0.18
66 0.22
67 0.23
68 0.23
69 0.24
70 0.22
71 0.2
72 0.2
73 0.15
74 0.12
75 0.14
76 0.15
77 0.2
78 0.2
79 0.21
80 0.2
81 0.21
82 0.25
83 0.3
84 0.31
85 0.31
86 0.33
87 0.35
88 0.39
89 0.42
90 0.42
91 0.36