Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T6ZEL3

Protein Details
Accession A0A2T6ZEL3    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
48-71KSESEMGKRPKRKTSRAQERDDSGBasic
NLS Segment(s)
PositionSequence
47-68GKSESEMGKRPKRKTSRAQERD
71-72GK
80-99QKQRTRPDKSESKMGGPKRE
111-113RKR
Subcellular Location(s) mito 22, nucl 4
Family & Domain DBs
Amino Acid Sequences MRAPNSNSAARVFFCATASPRGKLFGARQRPGTISPFTTTRARMRQGKSESEMGKRPKRKTSRAQERDDSGKGLANPQSQKQRTRPDKSESKMGGPKREASEAQEGVGPQRKRARASGWKEYLKEAGLYDPETCENAAPPSELNSKQRGRIVRNYNKRHDALFRHIAIPDFNLRSVVAGSKKVQPPEAADSNFETDNEANLELITDQNAIIYDSTGNGTVATVHPIKRGGSLGGFLFWLSCSGPGGLGGRLYYEMPKRERSLLSKSVQK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.23
3 0.24
4 0.31
5 0.33
6 0.31
7 0.3
8 0.32
9 0.32
10 0.33
11 0.38
12 0.39
13 0.46
14 0.48
15 0.51
16 0.52
17 0.54
18 0.52
19 0.48
20 0.42
21 0.35
22 0.33
23 0.31
24 0.32
25 0.33
26 0.33
27 0.37
28 0.4
29 0.44
30 0.5
31 0.52
32 0.58
33 0.6
34 0.62
35 0.59
36 0.59
37 0.56
38 0.52
39 0.56
40 0.55
41 0.59
42 0.61
43 0.62
44 0.65
45 0.71
46 0.75
47 0.78
48 0.8
49 0.82
50 0.83
51 0.85
52 0.81
53 0.77
54 0.73
55 0.64
56 0.54
57 0.43
58 0.37
59 0.29
60 0.28
61 0.27
62 0.27
63 0.27
64 0.31
65 0.41
66 0.42
67 0.48
68 0.51
69 0.58
70 0.62
71 0.68
72 0.69
73 0.67
74 0.72
75 0.69
76 0.71
77 0.62
78 0.58
79 0.56
80 0.54
81 0.53
82 0.46
83 0.47
84 0.4
85 0.41
86 0.35
87 0.33
88 0.35
89 0.28
90 0.27
91 0.23
92 0.21
93 0.2
94 0.27
95 0.23
96 0.2
97 0.26
98 0.29
99 0.3
100 0.32
101 0.38
102 0.4
103 0.47
104 0.53
105 0.54
106 0.54
107 0.53
108 0.51
109 0.45
110 0.35
111 0.29
112 0.19
113 0.13
114 0.11
115 0.11
116 0.1
117 0.09
118 0.09
119 0.09
120 0.08
121 0.07
122 0.07
123 0.07
124 0.07
125 0.06
126 0.06
127 0.09
128 0.13
129 0.15
130 0.18
131 0.24
132 0.25
133 0.28
134 0.32
135 0.34
136 0.35
137 0.41
138 0.49
139 0.52
140 0.61
141 0.66
142 0.68
143 0.69
144 0.65
145 0.59
146 0.54
147 0.49
148 0.46
149 0.45
150 0.4
151 0.35
152 0.35
153 0.33
154 0.27
155 0.24
156 0.21
157 0.16
158 0.14
159 0.13
160 0.13
161 0.13
162 0.13
163 0.14
164 0.12
165 0.14
166 0.16
167 0.23
168 0.27
169 0.28
170 0.29
171 0.27
172 0.29
173 0.33
174 0.36
175 0.3
176 0.28
177 0.28
178 0.29
179 0.28
180 0.24
181 0.19
182 0.14
183 0.14
184 0.13
185 0.12
186 0.09
187 0.09
188 0.09
189 0.07
190 0.07
191 0.07
192 0.06
193 0.05
194 0.06
195 0.06
196 0.06
197 0.06
198 0.07
199 0.06
200 0.06
201 0.08
202 0.08
203 0.08
204 0.07
205 0.07
206 0.08
207 0.08
208 0.12
209 0.14
210 0.14
211 0.16
212 0.18
213 0.19
214 0.2
215 0.21
216 0.19
217 0.17
218 0.18
219 0.17
220 0.15
221 0.15
222 0.12
223 0.11
224 0.09
225 0.09
226 0.08
227 0.08
228 0.08
229 0.08
230 0.09
231 0.1
232 0.12
233 0.11
234 0.12
235 0.11
236 0.11
237 0.12
238 0.13
239 0.17
240 0.22
241 0.28
242 0.32
243 0.38
244 0.41
245 0.46
246 0.51
247 0.51
248 0.54
249 0.55