Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T6ZEC2

Protein Details
Accession A0A2T6ZEC2    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
76-97RFVSFCRRTFCRRHNRRFAVQPHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 13, mito 4, extr 4, cyto 2, golg 2, mito_nucl 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MLGELDAGRLWGVGVLCRDRWKDGRKVSLLLYILLSLPLISWLSAVIVSKQLNEKKFPTLSCELAIKGFCAFYSWRFVSFCRRTFCRRHNRRFAVQP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.15
3 0.17
4 0.22
5 0.24
6 0.27
7 0.34
8 0.39
9 0.44
10 0.48
11 0.55
12 0.53
13 0.53
14 0.49
15 0.47
16 0.41
17 0.33
18 0.26
19 0.18
20 0.15
21 0.13
22 0.11
23 0.05
24 0.04
25 0.05
26 0.04
27 0.04
28 0.04
29 0.04
30 0.04
31 0.05
32 0.05
33 0.04
34 0.07
35 0.07
36 0.08
37 0.14
38 0.18
39 0.19
40 0.22
41 0.23
42 0.25
43 0.28
44 0.27
45 0.28
46 0.28
47 0.27
48 0.26
49 0.26
50 0.22
51 0.21
52 0.21
53 0.15
54 0.12
55 0.1
56 0.08
57 0.09
58 0.1
59 0.1
60 0.18
61 0.18
62 0.2
63 0.21
64 0.23
65 0.31
66 0.38
67 0.43
68 0.42
69 0.47
70 0.52
71 0.61
72 0.7
73 0.7
74 0.74
75 0.79
76 0.83
77 0.86