Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T6ZE30

Protein Details
Accession A0A2T6ZE30    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
8-30SIPTSFDRRSRRPAKRRALSPASHydrophilic
NLS Segment(s)
PositionSequence
16-24RSRRPAKRR
Subcellular Location(s) nucl 15.5, cyto_nucl 10, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR009548  Prkrip1  
Gene Ontology GO:0003725  F:double-stranded RNA binding  
Pfam View protein in Pfam  
PF06658  DUF1168  
Amino Acid Sequences MSEPIPESIPTSFDRRSRRPAKRRALSPASAQAATLTALFAKPDREIHIPKPGAPKVLPPPPEIVANVQGSSAGAGSGEFHVYKAARRREYERIRLMEEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.42
3 0.52
4 0.6
5 0.68
6 0.73
7 0.79
8 0.84
9 0.84
10 0.84
11 0.83
12 0.8
13 0.72
14 0.66
15 0.63
16 0.55
17 0.45
18 0.39
19 0.29
20 0.23
21 0.2
22 0.15
23 0.08
24 0.05
25 0.05
26 0.05
27 0.06
28 0.06
29 0.07
30 0.08
31 0.12
32 0.16
33 0.2
34 0.22
35 0.3
36 0.29
37 0.31
38 0.36
39 0.33
40 0.32
41 0.29
42 0.31
43 0.28
44 0.34
45 0.33
46 0.28
47 0.3
48 0.28
49 0.3
50 0.26
51 0.22
52 0.2
53 0.19
54 0.18
55 0.15
56 0.13
57 0.12
58 0.11
59 0.09
60 0.04
61 0.03
62 0.03
63 0.05
64 0.05
65 0.07
66 0.07
67 0.07
68 0.1
69 0.11
70 0.17
71 0.25
72 0.33
73 0.37
74 0.42
75 0.49
76 0.57
77 0.66
78 0.7
79 0.71
80 0.67