Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T6ZEN8

Protein Details
Accession A0A2T6ZEN8   
Localization Confidence Medium
Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
82-108KARVEEQQKINKRKRAERRVERNSIGDHydrophilic
NLS Segment(s)
PositionSequence
92-100NKRKRAERR
Subcellular Location(s) cyto_nucl 12.5, nucl 12, cyto 11, cysk 4
Family & Domain DBs
Amino Acid Sequences MSDAISVSGEWDGLGGSAGLDYQDPVFELGDERADGGETETNDGKHKHENYIVCAMVSSTKAKAVPMSEEDAEIVVQYEIHKARVEEQQKINKRKRAERRVERNSIGDIGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.04
3 0.04
4 0.03
5 0.04
6 0.04
7 0.04
8 0.05
9 0.04
10 0.05
11 0.05
12 0.06
13 0.06
14 0.06
15 0.07
16 0.07
17 0.08
18 0.08
19 0.08
20 0.07
21 0.07
22 0.07
23 0.07
24 0.09
25 0.08
26 0.11
27 0.12
28 0.12
29 0.14
30 0.15
31 0.16
32 0.2
33 0.22
34 0.22
35 0.26
36 0.27
37 0.28
38 0.31
39 0.29
40 0.22
41 0.2
42 0.17
43 0.14
44 0.13
45 0.11
46 0.07
47 0.08
48 0.09
49 0.09
50 0.1
51 0.1
52 0.12
53 0.13
54 0.16
55 0.15
56 0.14
57 0.14
58 0.13
59 0.12
60 0.09
61 0.08
62 0.05
63 0.05
64 0.05
65 0.09
66 0.1
67 0.11
68 0.13
69 0.12
70 0.17
71 0.25
72 0.29
73 0.32
74 0.39
75 0.48
76 0.57
77 0.67
78 0.72
79 0.7
80 0.74
81 0.77
82 0.8
83 0.81
84 0.83
85 0.84
86 0.86
87 0.9
88 0.9
89 0.84
90 0.76
91 0.68