Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T6ZXL6

Protein Details
Accession A0A2T6ZXL6   
Localization Confidence Medium
Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
15-41APFGYTKAGKPRKRPVRNKKEGVCPVKHydrophilic
NLS Segment(s)
PositionSequence
21-34KAGKPRKRPVRNKK
Subcellular Location(s) nucl 15.5, mito_nucl 13.5, mito 10.5
Family & Domain DBs
Amino Acid Sequences MAPSMISQPTTPPIAPFGYTKAGKPRKRPVRNKKEGVCPVKECQRSFKHRPNPKDAIWQHLAYYRSPMCAEPSSSPFRQAHITMHQKMKAESQSKRLSGINIF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.21
3 0.2
4 0.2
5 0.24
6 0.25
7 0.26
8 0.34
9 0.43
10 0.47
11 0.55
12 0.62
13 0.66
14 0.76
15 0.85
16 0.85
17 0.87
18 0.91
19 0.92
20 0.87
21 0.86
22 0.85
23 0.8
24 0.73
25 0.66
26 0.6
27 0.59
28 0.58
29 0.48
30 0.47
31 0.49
32 0.52
33 0.57
34 0.62
35 0.63
36 0.66
37 0.71
38 0.72
39 0.69
40 0.62
41 0.64
42 0.55
43 0.51
44 0.47
45 0.41
46 0.34
47 0.33
48 0.32
49 0.22
50 0.26
51 0.19
52 0.18
53 0.18
54 0.18
55 0.18
56 0.18
57 0.21
58 0.19
59 0.24
60 0.29
61 0.28
62 0.33
63 0.29
64 0.29
65 0.31
66 0.29
67 0.29
68 0.32
69 0.4
70 0.42
71 0.47
72 0.49
73 0.47
74 0.46
75 0.48
76 0.48
77 0.47
78 0.45
79 0.48
80 0.54
81 0.53
82 0.55
83 0.5