Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T6ZRF3

Protein Details
Accession A0A2T6ZRF3    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
5-27ERDYTKSRKRADQLQKEKDHSRSBasic
NLS Segment(s)
Subcellular Location(s) nucl 22, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR026183  Taxilin_fam  
Gene Ontology GO:0019905  F:syntaxin binding  
Pfam View protein in Pfam  
PF09728  Taxilin  
Amino Acid Sequences MKRLERDYTKSRKRADQLQKEKDHSRSEMQKAVSMKNKLETLCRELQKENKRIKDESKKLAQNEQLKREELSNKFENTIMEIKTRMGEENDDGSRKVNAGVDELFKAKFKSLVDQYEMRELHCYSLIRTKELEVQWNLARYEQQRKQAEQEAHRAKALHAQVSTFSQTEAELRSQLNIYVEKFKQIP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.78
3 0.79
4 0.79
5 0.82
6 0.84
7 0.81
8 0.81
9 0.77
10 0.71
11 0.64
12 0.61
13 0.6
14 0.57
15 0.57
16 0.51
17 0.49
18 0.47
19 0.49
20 0.48
21 0.43
22 0.4
23 0.38
24 0.4
25 0.37
26 0.4
27 0.37
28 0.36
29 0.41
30 0.42
31 0.4
32 0.41
33 0.5
34 0.54
35 0.58
36 0.6
37 0.59
38 0.61
39 0.62
40 0.67
41 0.69
42 0.67
43 0.66
44 0.66
45 0.64
46 0.62
47 0.64
48 0.62
49 0.6
50 0.6
51 0.59
52 0.53
53 0.49
54 0.47
55 0.44
56 0.44
57 0.37
58 0.37
59 0.33
60 0.31
61 0.31
62 0.31
63 0.27
64 0.24
65 0.24
66 0.18
67 0.15
68 0.15
69 0.14
70 0.14
71 0.15
72 0.12
73 0.09
74 0.1
75 0.1
76 0.13
77 0.14
78 0.14
79 0.13
80 0.13
81 0.13
82 0.12
83 0.11
84 0.09
85 0.09
86 0.1
87 0.1
88 0.11
89 0.11
90 0.12
91 0.12
92 0.11
93 0.11
94 0.09
95 0.11
96 0.11
97 0.16
98 0.19
99 0.22
100 0.25
101 0.28
102 0.29
103 0.33
104 0.32
105 0.27
106 0.25
107 0.22
108 0.2
109 0.2
110 0.19
111 0.14
112 0.21
113 0.22
114 0.21
115 0.21
116 0.22
117 0.25
118 0.26
119 0.31
120 0.25
121 0.28
122 0.28
123 0.31
124 0.3
125 0.24
126 0.27
127 0.25
128 0.34
129 0.35
130 0.42
131 0.44
132 0.47
133 0.51
134 0.55
135 0.59
136 0.53
137 0.58
138 0.56
139 0.53
140 0.52
141 0.47
142 0.39
143 0.4
144 0.38
145 0.33
146 0.26
147 0.25
148 0.25
149 0.28
150 0.3
151 0.22
152 0.19
153 0.15
154 0.15
155 0.16
156 0.17
157 0.15
158 0.15
159 0.15
160 0.17
161 0.18
162 0.19
163 0.2
164 0.21
165 0.22
166 0.28
167 0.28