Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T6ZZ48

Protein Details
Accession A0A2T6ZZ48    Localization Confidence High Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
140-161KEGTIRKKKGKAGGKAKKAVKLBasic
NLS Segment(s)
PositionSequence
109-115KGKKRKV
142-159GTIRKKKGKAGGKAKKAV
Subcellular Location(s) nucl 21.5, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR027911  DUF4604  
Pfam View protein in Pfam  
PF15377  DUF4604  
Amino Acid Sequences MSKGSKNLTYEMEEPAFLRRLRQQHSGGGGPERYIAPRNKKQPTDEDDDAPTYVLDEVSGETLSKKEFEAMNNGEIVEEREGEEGGGIIKIPEEKPVAEKVNITEIGGKGKKRKVAKIIGDGDEDDAAEKDENNDKGNEKEGTIRKKKGKAGGKAKKAVKLSFGDDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.26
3 0.28
4 0.23
5 0.25
6 0.26
7 0.33
8 0.38
9 0.45
10 0.45
11 0.45
12 0.5
13 0.5
14 0.45
15 0.42
16 0.37
17 0.3
18 0.28
19 0.23
20 0.2
21 0.23
22 0.28
23 0.33
24 0.41
25 0.5
26 0.57
27 0.61
28 0.63
29 0.66
30 0.65
31 0.64
32 0.59
33 0.52
34 0.46
35 0.43
36 0.38
37 0.29
38 0.22
39 0.14
40 0.11
41 0.08
42 0.06
43 0.05
44 0.05
45 0.05
46 0.06
47 0.05
48 0.05
49 0.06
50 0.07
51 0.07
52 0.07
53 0.09
54 0.1
55 0.11
56 0.17
57 0.19
58 0.19
59 0.18
60 0.18
61 0.15
62 0.14
63 0.14
64 0.08
65 0.07
66 0.06
67 0.06
68 0.06
69 0.06
70 0.06
71 0.04
72 0.04
73 0.04
74 0.03
75 0.03
76 0.03
77 0.05
78 0.05
79 0.07
80 0.08
81 0.08
82 0.11
83 0.15
84 0.18
85 0.17
86 0.17
87 0.16
88 0.2
89 0.2
90 0.18
91 0.16
92 0.14
93 0.21
94 0.23
95 0.24
96 0.26
97 0.3
98 0.36
99 0.38
100 0.45
101 0.46
102 0.53
103 0.57
104 0.59
105 0.61
106 0.57
107 0.53
108 0.47
109 0.39
110 0.3
111 0.23
112 0.15
113 0.1
114 0.09
115 0.07
116 0.07
117 0.09
118 0.15
119 0.17
120 0.18
121 0.2
122 0.21
123 0.23
124 0.27
125 0.26
126 0.21
127 0.28
128 0.34
129 0.42
130 0.48
131 0.56
132 0.59
133 0.66
134 0.71
135 0.72
136 0.74
137 0.74
138 0.77
139 0.79
140 0.81
141 0.82
142 0.81
143 0.78
144 0.75
145 0.66
146 0.61
147 0.55