Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T6ZE84

Protein Details
Accession A0A2T6ZE84   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
26-49GAHARWRRRISRFKGNRQFPREVKBasic
NLS Segment(s)
PositionSequence
29-56ARWRRRISRFKGNRQFPREVKGREGKGR
Subcellular Location(s) mito 15, extr 9, cyto_mito 9
Family & Domain DBs
Amino Acid Sequences MTLTTIVLILVESLPLPPSLAAYIHGAHARWRRRISRFKGNRQFPREVKGREGKGREGGNVLLNCGLCPIISGPPVGKNLAGSPGRTDRVIAVTYKALPVSWPAQIKSLTTGRKLGYKSFTKCELP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.07
4 0.06
5 0.07
6 0.08
7 0.08
8 0.09
9 0.11
10 0.11
11 0.13
12 0.14
13 0.14
14 0.19
15 0.27
16 0.32
17 0.37
18 0.43
19 0.48
20 0.56
21 0.66
22 0.67
23 0.71
24 0.75
25 0.79
26 0.82
27 0.85
28 0.85
29 0.81
30 0.82
31 0.72
32 0.69
33 0.66
34 0.58
35 0.55
36 0.53
37 0.51
38 0.49
39 0.5
40 0.45
41 0.43
42 0.41
43 0.35
44 0.29
45 0.25
46 0.23
47 0.2
48 0.18
49 0.14
50 0.13
51 0.12
52 0.11
53 0.1
54 0.05
55 0.05
56 0.06
57 0.06
58 0.07
59 0.07
60 0.08
61 0.1
62 0.12
63 0.12
64 0.11
65 0.1
66 0.1
67 0.16
68 0.17
69 0.14
70 0.17
71 0.21
72 0.22
73 0.22
74 0.21
75 0.16
76 0.18
77 0.19
78 0.16
79 0.14
80 0.14
81 0.15
82 0.15
83 0.14
84 0.11
85 0.11
86 0.13
87 0.14
88 0.17
89 0.2
90 0.2
91 0.23
92 0.24
93 0.25
94 0.27
95 0.32
96 0.31
97 0.3
98 0.34
99 0.32
100 0.38
101 0.39
102 0.39
103 0.41
104 0.45
105 0.48
106 0.5