Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T6ZRD6

Protein Details
Accession A0A2T6ZRD6    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
18-39EESKRGKPEKSVKKQKFKSPISBasic
NLS Segment(s)
PositionSequence
9-35KANEKFAKREESKRGKPEKSVKKQKFK
Subcellular Location(s) plas 12, mito 5, E.R. 4, mito_nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR010580  ER_stress-assoc  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0015031  P:protein transport  
Pfam View protein in Pfam  
PF06624  RAMP4  
Amino Acid Sequences MAQTPQQRKANEKFAKREESKRGKPEKSVKKQKFKSPISQGWLIVVGFAVFGGIVFELIRMFF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.72
3 0.7
4 0.71
5 0.71
6 0.73
7 0.73
8 0.74
9 0.76
10 0.69
11 0.72
12 0.75
13 0.75
14 0.76
15 0.79
16 0.78
17 0.8
18 0.82
19 0.82
20 0.82
21 0.75
22 0.74
23 0.71
24 0.68
25 0.63
26 0.6
27 0.52
28 0.42
29 0.39
30 0.29
31 0.2
32 0.14
33 0.08
34 0.05
35 0.05
36 0.04
37 0.02
38 0.02
39 0.03
40 0.03
41 0.03
42 0.04
43 0.04