Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T6ZVL1

Protein Details
Accession A0A2T6ZVL1   
Localization Confidence Low
Confidence Score 5.7
NoLS Segment(s)
PositionSequenceProtein Nature
2-27SPPPLLPLPPPLRKQRRRYNLISSIFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, plas 10, nucl 2, cyto 2, cyto_nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR013875  Pam17  
Gene Ontology GO:0001405  C:PAM complex, Tim23 associated import motor  
GO:0030150  P:protein import into mitochondrial matrix  
Pfam View protein in Pfam  
PF08566  Pam17  
Amino Acid Sequences MSPPPLLPLPPPLRKQRRRYNLISSIFTSAVGTTAGVSYLANKEIDPTQMIMGMDPIILFGIATVSCGALGWLAGPVLGSSAFSVVKRRVMGQINEREREFLQHIKKNRVDPSFQSFRNPVPDYYGEKIGSIKQYKQWLKDQRAYNRKSFL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.8
3 0.81
4 0.83
5 0.84
6 0.84
7 0.83
8 0.82
9 0.78
10 0.71
11 0.62
12 0.55
13 0.47
14 0.4
15 0.3
16 0.2
17 0.15
18 0.11
19 0.09
20 0.06
21 0.06
22 0.06
23 0.05
24 0.05
25 0.07
26 0.08
27 0.09
28 0.09
29 0.09
30 0.11
31 0.12
32 0.13
33 0.12
34 0.12
35 0.11
36 0.13
37 0.13
38 0.11
39 0.1
40 0.09
41 0.07
42 0.06
43 0.06
44 0.03
45 0.03
46 0.03
47 0.02
48 0.03
49 0.03
50 0.04
51 0.04
52 0.04
53 0.04
54 0.04
55 0.04
56 0.03
57 0.03
58 0.03
59 0.03
60 0.02
61 0.02
62 0.03
63 0.02
64 0.03
65 0.03
66 0.03
67 0.03
68 0.04
69 0.05
70 0.05
71 0.08
72 0.09
73 0.12
74 0.13
75 0.14
76 0.18
77 0.23
78 0.26
79 0.32
80 0.4
81 0.43
82 0.45
83 0.44
84 0.4
85 0.36
86 0.36
87 0.31
88 0.28
89 0.31
90 0.35
91 0.41
92 0.47
93 0.51
94 0.54
95 0.58
96 0.54
97 0.5
98 0.49
99 0.52
100 0.51
101 0.47
102 0.47
103 0.41
104 0.4
105 0.44
106 0.42
107 0.34
108 0.32
109 0.35
110 0.36
111 0.38
112 0.4
113 0.32
114 0.3
115 0.31
116 0.29
117 0.33
118 0.32
119 0.31
120 0.33
121 0.43
122 0.48
123 0.52
124 0.58
125 0.6
126 0.65
127 0.7
128 0.73
129 0.74
130 0.78
131 0.78