Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T6ZRQ5

Protein Details
Accession A0A2T6ZRQ5    Localization Confidence Low Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
56-78KAELERLRRKRLEKHARRVEGGQBasic
NLS Segment(s)
PositionSequence
61-73RLRRKRLEKHARR
Subcellular Location(s) cyto 15.5, cyto_nucl 9, cysk 7, nucl 1.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018625  Pet100  
Gene Ontology GO:0016020  C:membrane  
GO:0005739  C:mitochondrion  
GO:0033617  P:mitochondrial cytochrome c oxidase assembly  
Pfam View protein in Pfam  
PF09803  Pet100  
Amino Acid Sequences MAGSNLEVFKFGIYIMFPIAIMYYFGTNLDNRFSVPGFWPKPEETHRIPFEKDEIKAELERLRRKRLEKHARRVEGGQQE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.07
4 0.07
5 0.07
6 0.07
7 0.06
8 0.06
9 0.06
10 0.06
11 0.06
12 0.06
13 0.07
14 0.08
15 0.09
16 0.1
17 0.09
18 0.09
19 0.1
20 0.1
21 0.1
22 0.12
23 0.19
24 0.19
25 0.2
26 0.22
27 0.21
28 0.25
29 0.28
30 0.31
31 0.28
32 0.34
33 0.37
34 0.37
35 0.37
36 0.34
37 0.36
38 0.34
39 0.31
40 0.26
41 0.24
42 0.24
43 0.24
44 0.25
45 0.25
46 0.29
47 0.37
48 0.4
49 0.47
50 0.51
51 0.56
52 0.64
53 0.7
54 0.74
55 0.75
56 0.81
57 0.83
58 0.82
59 0.8
60 0.74