Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T6ZJS4

Protein Details
Accession A0A2T6ZJS4    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
103-128VCGNRIRKKLPVPKKPKTFKVPKASVHydrophilic
NLS Segment(s)
PositionSequence
108-122IRKKLPVPKKPKTFK
Subcellular Location(s) mito 23, nucl 3
Family & Domain DBs
Amino Acid Sequences MTQEKRIFRSRKGVSDDVAILFEAMGVNCKPYPVVTAGAKDPFLGWFGASRKQFSDAPKACTKAETDSDLAAMRVQTAEVLELVKAALPASTKHLRVVLGIPVCGNRIRKKLPVPKKPKTFKVPKASVSAESCMMPATPNGMKPVSAVRTPSPKNAKVKIVQSCIRRSPRIKNSQGVSY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.55
3 0.51
4 0.41
5 0.35
6 0.26
7 0.18
8 0.14
9 0.13
10 0.09
11 0.06
12 0.08
13 0.08
14 0.1
15 0.1
16 0.11
17 0.11
18 0.1
19 0.13
20 0.13
21 0.17
22 0.17
23 0.2
24 0.22
25 0.24
26 0.24
27 0.21
28 0.19
29 0.15
30 0.14
31 0.11
32 0.09
33 0.11
34 0.13
35 0.2
36 0.2
37 0.21
38 0.21
39 0.25
40 0.28
41 0.28
42 0.37
43 0.34
44 0.39
45 0.42
46 0.43
47 0.39
48 0.37
49 0.35
50 0.28
51 0.27
52 0.24
53 0.2
54 0.18
55 0.19
56 0.17
57 0.16
58 0.12
59 0.1
60 0.07
61 0.05
62 0.05
63 0.04
64 0.04
65 0.04
66 0.04
67 0.04
68 0.04
69 0.04
70 0.04
71 0.04
72 0.04
73 0.04
74 0.04
75 0.04
76 0.05
77 0.11
78 0.14
79 0.14
80 0.15
81 0.16
82 0.16
83 0.16
84 0.17
85 0.16
86 0.13
87 0.13
88 0.13
89 0.12
90 0.13
91 0.15
92 0.17
93 0.18
94 0.23
95 0.26
96 0.31
97 0.4
98 0.49
99 0.57
100 0.64
101 0.69
102 0.74
103 0.81
104 0.83
105 0.83
106 0.82
107 0.82
108 0.81
109 0.82
110 0.78
111 0.71
112 0.7
113 0.63
114 0.58
115 0.5
116 0.42
117 0.33
118 0.27
119 0.23
120 0.17
121 0.15
122 0.11
123 0.08
124 0.11
125 0.11
126 0.13
127 0.16
128 0.16
129 0.16
130 0.16
131 0.23
132 0.22
133 0.22
134 0.24
135 0.26
136 0.35
137 0.37
138 0.46
139 0.48
140 0.51
141 0.57
142 0.6
143 0.63
144 0.6
145 0.66
146 0.65
147 0.64
148 0.64
149 0.62
150 0.64
151 0.67
152 0.68
153 0.68
154 0.65
155 0.68
156 0.73
157 0.77
158 0.76
159 0.75