Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T6ZFS5

Protein Details
Accession A0A2T6ZFS5   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
10-34KDEVPNPSRKIKKRNHAPFFPHCIWHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 19, mito 2, E.R. 2, golg 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MVSLGFFAAKDEVPNPSRKIKKRNHAPFFPHCIWSFFPLMPQSSILYIFYCTIFIPVISWVEAFFIRLFVYFLSLFTAIWRLFVVFSYLAFGWLCRFAYPLAMMTPVYT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.28
3 0.36
4 0.45
5 0.52
6 0.61
7 0.65
8 0.73
9 0.78
10 0.86
11 0.85
12 0.84
13 0.84
14 0.81
15 0.8
16 0.72
17 0.64
18 0.54
19 0.48
20 0.41
21 0.36
22 0.31
23 0.21
24 0.21
25 0.19
26 0.2
27 0.17
28 0.17
29 0.14
30 0.12
31 0.13
32 0.11
33 0.09
34 0.09
35 0.09
36 0.08
37 0.08
38 0.07
39 0.07
40 0.06
41 0.06
42 0.05
43 0.05
44 0.06
45 0.06
46 0.06
47 0.05
48 0.06
49 0.06
50 0.07
51 0.06
52 0.06
53 0.06
54 0.06
55 0.06
56 0.05
57 0.08
58 0.07
59 0.07
60 0.09
61 0.09
62 0.09
63 0.09
64 0.13
65 0.1
66 0.11
67 0.11
68 0.09
69 0.09
70 0.09
71 0.12
72 0.08
73 0.08
74 0.11
75 0.11
76 0.12
77 0.11
78 0.11
79 0.1
80 0.13
81 0.14
82 0.11
83 0.12
84 0.11
85 0.15
86 0.16
87 0.16
88 0.14
89 0.15