Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T7A9P1

Protein Details
Accession A0A2T7A9P1    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
88-108EPIPIEKPRGRPKKLKGMAKLBasic
NLS Segment(s)
PositionSequence
94-108KPRGRPKKLKGMAKL
Subcellular Location(s) plas 6, mito 4, extr 4, nucl 3, golg 3, cyto_mito 3, cyto 2, E.R. 2, vacu 2
Family & Domain DBs
Amino Acid Sequences MILTQPALLCTLLGWVAASVALPLDIGLDLEGMRNKLRSGSVAIANPYHPSDMRRERIMKQNGNIVYVESEPGPDFDSENPGEGLDSEPIPIEKPRGRPKKLKGMAKLAKSSETKC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.05
3 0.05
4 0.05
5 0.05
6 0.04
7 0.04
8 0.04
9 0.03
10 0.03
11 0.04
12 0.04
13 0.04
14 0.04
15 0.04
16 0.04
17 0.06
18 0.07
19 0.08
20 0.09
21 0.1
22 0.1
23 0.11
24 0.12
25 0.12
26 0.14
27 0.16
28 0.18
29 0.19
30 0.2
31 0.2
32 0.19
33 0.19
34 0.16
35 0.14
36 0.11
37 0.11
38 0.18
39 0.24
40 0.27
41 0.3
42 0.33
43 0.35
44 0.44
45 0.51
46 0.46
47 0.4
48 0.44
49 0.4
50 0.38
51 0.34
52 0.25
53 0.18
54 0.15
55 0.14
56 0.08
57 0.08
58 0.07
59 0.07
60 0.08
61 0.07
62 0.08
63 0.08
64 0.13
65 0.12
66 0.13
67 0.13
68 0.12
69 0.11
70 0.11
71 0.12
72 0.09
73 0.08
74 0.08
75 0.08
76 0.08
77 0.1
78 0.11
79 0.15
80 0.19
81 0.28
82 0.39
83 0.48
84 0.55
85 0.63
86 0.71
87 0.76
88 0.81
89 0.81
90 0.78
91 0.79
92 0.8
93 0.77
94 0.75
95 0.66
96 0.64