Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T6ZEU2

Protein Details
Accession A0A2T6ZEU2    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
49-68VPPYKKSSRKPLKRLQIPFEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10, nucl 8, cyto 4, pero 2, plas 1, E.R. 1, golg 1
Family & Domain DBs
Amino Acid Sequences MPLSVTYLISSLHVNWPTLCFIILAEIPQPLPQHSNISECPQLKYWKFVPPYKKSSRKPLKRLQIPFELPTHNRATIDINPGKSVELFSLTIDYSKGNIISQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.2
4 0.21
5 0.2
6 0.18
7 0.12
8 0.1
9 0.12
10 0.11
11 0.1
12 0.09
13 0.09
14 0.09
15 0.11
16 0.12
17 0.1
18 0.12
19 0.13
20 0.16
21 0.17
22 0.21
23 0.2
24 0.24
25 0.28
26 0.27
27 0.27
28 0.27
29 0.31
30 0.28
31 0.31
32 0.29
33 0.31
34 0.34
35 0.38
36 0.43
37 0.44
38 0.52
39 0.57
40 0.64
41 0.61
42 0.68
43 0.74
44 0.75
45 0.77
46 0.78
47 0.79
48 0.78
49 0.81
50 0.75
51 0.73
52 0.66
53 0.59
54 0.53
55 0.47
56 0.39
57 0.37
58 0.35
59 0.28
60 0.24
61 0.23
62 0.25
63 0.24
64 0.32
65 0.31
66 0.29
67 0.29
68 0.29
69 0.28
70 0.24
71 0.21
72 0.14
73 0.13
74 0.12
75 0.12
76 0.13
77 0.13
78 0.13
79 0.13
80 0.12
81 0.1
82 0.12