Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T7A6F5

Protein Details
Accession A0A2T7A6F5    Localization Confidence Low Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
18-40ELMPPPPPAKRIKRPPVVLDEDRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10cyto_nucl 10, mito 8, cyto 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR019148  Nuclear_protein_DGCR14_ESS-2  
Gene Ontology GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF09751  Es2  
Amino Acid Sequences MASSSADSKALIRKAGMELMPPPPPAKRIKRPPVVLDEDRYTDALSEIIARDFFPGLLETKHQQEYLDALDSHDTEWIREAGRKLTEVMTTPRLGRTRRGTSLVTPTPRAFRELSATPTTTSNPMAPAEGSGEKEVGKPVYEKHLSLDAFQAKYTSEDNASFNDLLDKQNQKKRSAYAFLWNDNRIPGFRTKVHQKRLKAQAESEEKAGGPPKSLAWKDDRKPFPNTWKAEPKNGLMFTPDLSPPPPPAPLSTDRELPPKAIAYSNTRMPAPPPPKLPSSPTRSVVYDAISGKPRPLPSESRFGAVETPRVNGYSFVDDAPSPSPSELGAPPLTWGSLAPISDPTTTPTPFKLAPTPKRELLHHRMVDRVAKGKRAPANPLLSAATAASGTPRMTPLGGNGKGREIPTFKSTPRAALTPAGQRLLGNLKAGRGGDSGIFGADTGTPGNAQSRFMPTPRAGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.33
3 0.3
4 0.26
5 0.26
6 0.29
7 0.33
8 0.31
9 0.3
10 0.27
11 0.32
12 0.39
13 0.45
14 0.52
15 0.59
16 0.68
17 0.76
18 0.8
19 0.82
20 0.81
21 0.8
22 0.74
23 0.69
24 0.63
25 0.56
26 0.51
27 0.44
28 0.35
29 0.26
30 0.21
31 0.15
32 0.11
33 0.1
34 0.1
35 0.11
36 0.11
37 0.11
38 0.12
39 0.12
40 0.12
41 0.11
42 0.11
43 0.12
44 0.13
45 0.16
46 0.17
47 0.22
48 0.25
49 0.24
50 0.23
51 0.22
52 0.23
53 0.23
54 0.24
55 0.19
56 0.18
57 0.19
58 0.19
59 0.18
60 0.19
61 0.16
62 0.12
63 0.15
64 0.15
65 0.15
66 0.19
67 0.2
68 0.22
69 0.24
70 0.25
71 0.24
72 0.25
73 0.25
74 0.24
75 0.27
76 0.26
77 0.26
78 0.27
79 0.3
80 0.33
81 0.33
82 0.38
83 0.42
84 0.45
85 0.48
86 0.51
87 0.47
88 0.47
89 0.54
90 0.54
91 0.49
92 0.45
93 0.42
94 0.43
95 0.41
96 0.4
97 0.32
98 0.26
99 0.28
100 0.27
101 0.31
102 0.3
103 0.3
104 0.28
105 0.28
106 0.28
107 0.24
108 0.23
109 0.18
110 0.16
111 0.15
112 0.15
113 0.13
114 0.13
115 0.14
116 0.14
117 0.15
118 0.13
119 0.13
120 0.13
121 0.14
122 0.15
123 0.12
124 0.12
125 0.12
126 0.13
127 0.21
128 0.22
129 0.22
130 0.22
131 0.28
132 0.27
133 0.27
134 0.31
135 0.27
136 0.26
137 0.25
138 0.23
139 0.17
140 0.19
141 0.19
142 0.14
143 0.11
144 0.13
145 0.14
146 0.15
147 0.18
148 0.16
149 0.15
150 0.16
151 0.15
152 0.15
153 0.19
154 0.25
155 0.29
156 0.35
157 0.4
158 0.41
159 0.43
160 0.47
161 0.48
162 0.47
163 0.42
164 0.45
165 0.45
166 0.46
167 0.47
168 0.43
169 0.37
170 0.32
171 0.31
172 0.21
173 0.2
174 0.18
175 0.18
176 0.2
177 0.24
178 0.34
179 0.42
180 0.51
181 0.55
182 0.56
183 0.61
184 0.69
185 0.7
186 0.61
187 0.55
188 0.54
189 0.54
190 0.51
191 0.42
192 0.33
193 0.26
194 0.25
195 0.27
196 0.18
197 0.12
198 0.11
199 0.12
200 0.18
201 0.18
202 0.19
203 0.23
204 0.31
205 0.35
206 0.44
207 0.48
208 0.46
209 0.51
210 0.53
211 0.55
212 0.56
213 0.54
214 0.52
215 0.56
216 0.54
217 0.54
218 0.53
219 0.45
220 0.41
221 0.38
222 0.32
223 0.23
224 0.21
225 0.16
226 0.16
227 0.14
228 0.1
229 0.1
230 0.11
231 0.11
232 0.12
233 0.13
234 0.11
235 0.12
236 0.16
237 0.21
238 0.25
239 0.25
240 0.28
241 0.28
242 0.32
243 0.31
244 0.26
245 0.23
246 0.19
247 0.18
248 0.16
249 0.17
250 0.19
251 0.22
252 0.24
253 0.24
254 0.23
255 0.22
256 0.22
257 0.29
258 0.28
259 0.29
260 0.3
261 0.32
262 0.36
263 0.38
264 0.41
265 0.4
266 0.43
267 0.44
268 0.43
269 0.42
270 0.39
271 0.4
272 0.36
273 0.29
274 0.25
275 0.21
276 0.21
277 0.22
278 0.21
279 0.2
280 0.23
281 0.22
282 0.21
283 0.24
284 0.29
285 0.29
286 0.38
287 0.37
288 0.35
289 0.35
290 0.33
291 0.33
292 0.26
293 0.27
294 0.19
295 0.2
296 0.18
297 0.19
298 0.18
299 0.15
300 0.16
301 0.14
302 0.14
303 0.13
304 0.14
305 0.13
306 0.14
307 0.15
308 0.14
309 0.11
310 0.1
311 0.1
312 0.09
313 0.12
314 0.11
315 0.13
316 0.13
317 0.12
318 0.13
319 0.13
320 0.13
321 0.1
322 0.09
323 0.09
324 0.1
325 0.1
326 0.1
327 0.12
328 0.14
329 0.15
330 0.15
331 0.16
332 0.18
333 0.2
334 0.2
335 0.19
336 0.21
337 0.21
338 0.24
339 0.29
340 0.35
341 0.43
342 0.49
343 0.53
344 0.55
345 0.57
346 0.59
347 0.59
348 0.57
349 0.59
350 0.56
351 0.52
352 0.49
353 0.49
354 0.5
355 0.44
356 0.44
357 0.37
358 0.38
359 0.39
360 0.43
361 0.48
362 0.46
363 0.49
364 0.48
365 0.51
366 0.46
367 0.46
368 0.4
369 0.33
370 0.29
371 0.23
372 0.16
373 0.1
374 0.09
375 0.08
376 0.08
377 0.09
378 0.09
379 0.1
380 0.11
381 0.11
382 0.12
383 0.17
384 0.25
385 0.28
386 0.31
387 0.31
388 0.34
389 0.36
390 0.37
391 0.36
392 0.3
393 0.3
394 0.33
395 0.37
396 0.34
397 0.39
398 0.4
399 0.4
400 0.41
401 0.39
402 0.35
403 0.35
404 0.38
405 0.38
406 0.41
407 0.37
408 0.33
409 0.31
410 0.32
411 0.33
412 0.3
413 0.26
414 0.24
415 0.23
416 0.27
417 0.27
418 0.26
419 0.2
420 0.2
421 0.16
422 0.16
423 0.16
424 0.12
425 0.12
426 0.09
427 0.1
428 0.08
429 0.08
430 0.07
431 0.08
432 0.08
433 0.09
434 0.14
435 0.14
436 0.16
437 0.18
438 0.25
439 0.29
440 0.3
441 0.36
442 0.36