Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T6ZW80

Protein Details
Accession A0A2T6ZW80   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
137-164DLRNGIIKTAKKRKRNKPRNLNSKEMAEHydrophilic
NLS Segment(s)
PositionSequence
144-155KTAKKRKRNKPR
Subcellular Location(s) E.R. 6, nucl 5, mito 5, mito_nucl 5, pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR011665  BRF1_TBP-bd_dom  
Pfam View protein in Pfam  
PF07741  BRF1  
Amino Acid Sequences MHKELMKMVMRDLSLIIAALVAVVGVGAYVIDMWEKRLPAAVIAILVEKNKNQDMPTGRRRLRNPRTLRPSATSDLLTALNTNRHHRPPIPQGVKKAQDEQHSAIAEESIASEIASLLDGSATTTLASIKRLNKETDLRNGIIKTAKKRKRNKPRNLNSKEMAENMLMCKSYSKKINYKAIEGLFEDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.13
3 0.1
4 0.06
5 0.06
6 0.05
7 0.04
8 0.03
9 0.02
10 0.02
11 0.02
12 0.02
13 0.02
14 0.01
15 0.02
16 0.02
17 0.02
18 0.04
19 0.04
20 0.08
21 0.1
22 0.11
23 0.11
24 0.14
25 0.14
26 0.14
27 0.15
28 0.12
29 0.1
30 0.1
31 0.11
32 0.09
33 0.1
34 0.1
35 0.1
36 0.13
37 0.14
38 0.15
39 0.15
40 0.2
41 0.26
42 0.34
43 0.42
44 0.49
45 0.51
46 0.57
47 0.63
48 0.68
49 0.7
50 0.72
51 0.71
52 0.72
53 0.77
54 0.74
55 0.71
56 0.64
57 0.6
58 0.53
59 0.46
60 0.36
61 0.27
62 0.24
63 0.21
64 0.17
65 0.12
66 0.1
67 0.13
68 0.14
69 0.18
70 0.21
71 0.22
72 0.25
73 0.26
74 0.32
75 0.35
76 0.44
77 0.48
78 0.47
79 0.5
80 0.54
81 0.57
82 0.52
83 0.49
84 0.43
85 0.39
86 0.4
87 0.37
88 0.34
89 0.3
90 0.29
91 0.23
92 0.19
93 0.14
94 0.1
95 0.08
96 0.04
97 0.04
98 0.03
99 0.03
100 0.03
101 0.04
102 0.04
103 0.03
104 0.03
105 0.03
106 0.03
107 0.03
108 0.04
109 0.04
110 0.03
111 0.04
112 0.05
113 0.06
114 0.09
115 0.13
116 0.17
117 0.23
118 0.27
119 0.29
120 0.33
121 0.39
122 0.41
123 0.46
124 0.46
125 0.41
126 0.41
127 0.39
128 0.37
129 0.36
130 0.36
131 0.37
132 0.44
133 0.51
134 0.57
135 0.68
136 0.76
137 0.82
138 0.88
139 0.9
140 0.9
141 0.93
142 0.95
143 0.91
144 0.88
145 0.81
146 0.76
147 0.68
148 0.58
149 0.49
150 0.39
151 0.33
152 0.26
153 0.24
154 0.19
155 0.16
156 0.19
157 0.2
158 0.26
159 0.32
160 0.38
161 0.45
162 0.53
163 0.63
164 0.63
165 0.64
166 0.65
167 0.59
168 0.55