Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q2UT76

Protein Details
Accession Q2UT76    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
51-81DGPPKYRQAKSARMKKKKPVERARPPPVGERBasic
NLS Segment(s)
PositionSequence
45-87KKKNSLDGPPKYRQAKSARMKKKKPVERARPPPVGERKALRKR
Subcellular Location(s) mito 23.5, cyto_mito 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019368  Ribosomal_S23/S29_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
KEGG aor:AO090005000128  -  
Pfam View protein in Pfam  
PF10236  DAP3  
Amino Acid Sequences MVSSFCWGCLTRLRPTPRAVLPPTVAAPRAAAFHTSTVRYALPTKKKNSLDGPPKYRQAKSARMKKKKPVERARPPPVGERKALRKRIVLSNPNALEVEGMQDFTSETMVDARLRGSILGLPVPMLTQLRAVEAFKPKQGWSIFRRPGTVVRRETLELGRLIDSISNEGQDKGRSVKKIVTGVRGSGKTVHLLQAMAMAFTKQWVVFTVPEPQDLVIAHTGYAPLSDETPNLYVQNEATATLLSRTVVANEQVLKTLHVSREHAALKSSVKAGMTLEELAKLGIQDPAIAWTVFQALWAELTATSAASGFDKNFKPRPPMLVTVDGLAHWMKNSEYRSVEFEPIHAHDLVFVRHFLGLLKPGTGKPALPNGGLLLYSTSASNNPTIYSFEVALKQIAARQAGLNASAPEFPQADPYSGADKRVIDAFDSSKPTVAKEGMLELQTLGGLTRDEARGFMEYFARSGLLREKINDEWVGEKWSLAGGGVIGELEKLGRRLRVTD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.55
3 0.61
4 0.59
5 0.63
6 0.59
7 0.57
8 0.52
9 0.5
10 0.49
11 0.44
12 0.38
13 0.3
14 0.27
15 0.21
16 0.22
17 0.19
18 0.18
19 0.16
20 0.19
21 0.23
22 0.23
23 0.23
24 0.23
25 0.23
26 0.23
27 0.29
28 0.34
29 0.4
30 0.47
31 0.53
32 0.6
33 0.63
34 0.67
35 0.68
36 0.69
37 0.69
38 0.71
39 0.73
40 0.71
41 0.76
42 0.75
43 0.69
44 0.67
45 0.65
46 0.65
47 0.67
48 0.71
49 0.73
50 0.78
51 0.85
52 0.86
53 0.89
54 0.88
55 0.89
56 0.89
57 0.89
58 0.89
59 0.92
60 0.91
61 0.88
62 0.81
63 0.8
64 0.78
65 0.72
66 0.66
67 0.63
68 0.65
69 0.67
70 0.73
71 0.67
72 0.63
73 0.63
74 0.68
75 0.7
76 0.68
77 0.62
78 0.63
79 0.6
80 0.55
81 0.5
82 0.4
83 0.3
84 0.22
85 0.2
86 0.11
87 0.1
88 0.08
89 0.08
90 0.08
91 0.08
92 0.08
93 0.05
94 0.05
95 0.06
96 0.08
97 0.09
98 0.09
99 0.09
100 0.1
101 0.1
102 0.09
103 0.09
104 0.09
105 0.1
106 0.1
107 0.1
108 0.09
109 0.09
110 0.09
111 0.1
112 0.09
113 0.08
114 0.09
115 0.09
116 0.1
117 0.12
118 0.13
119 0.17
120 0.24
121 0.26
122 0.26
123 0.28
124 0.27
125 0.33
126 0.34
127 0.36
128 0.36
129 0.45
130 0.49
131 0.48
132 0.5
133 0.45
134 0.51
135 0.51
136 0.52
137 0.45
138 0.4
139 0.41
140 0.4
141 0.41
142 0.34
143 0.3
144 0.22
145 0.2
146 0.19
147 0.16
148 0.15
149 0.14
150 0.12
151 0.12
152 0.11
153 0.11
154 0.11
155 0.12
156 0.13
157 0.12
158 0.14
159 0.16
160 0.2
161 0.21
162 0.22
163 0.25
164 0.28
165 0.35
166 0.36
167 0.37
168 0.34
169 0.35
170 0.39
171 0.35
172 0.32
173 0.27
174 0.25
175 0.2
176 0.2
177 0.19
178 0.14
179 0.14
180 0.13
181 0.14
182 0.13
183 0.11
184 0.1
185 0.08
186 0.07
187 0.08
188 0.09
189 0.05
190 0.05
191 0.06
192 0.08
193 0.09
194 0.11
195 0.19
196 0.18
197 0.19
198 0.19
199 0.18
200 0.17
201 0.15
202 0.16
203 0.09
204 0.08
205 0.08
206 0.08
207 0.08
208 0.07
209 0.07
210 0.06
211 0.05
212 0.06
213 0.06
214 0.06
215 0.08
216 0.09
217 0.1
218 0.09
219 0.09
220 0.08
221 0.07
222 0.09
223 0.07
224 0.06
225 0.06
226 0.06
227 0.06
228 0.06
229 0.06
230 0.05
231 0.05
232 0.05
233 0.06
234 0.07
235 0.07
236 0.08
237 0.09
238 0.09
239 0.1
240 0.1
241 0.1
242 0.11
243 0.13
244 0.14
245 0.15
246 0.17
247 0.16
248 0.22
249 0.22
250 0.21
251 0.19
252 0.18
253 0.18
254 0.17
255 0.17
256 0.12
257 0.11
258 0.11
259 0.1
260 0.1
261 0.1
262 0.09
263 0.09
264 0.08
265 0.08
266 0.07
267 0.07
268 0.06
269 0.05
270 0.06
271 0.05
272 0.05
273 0.05
274 0.07
275 0.08
276 0.08
277 0.07
278 0.06
279 0.08
280 0.07
281 0.07
282 0.06
283 0.05
284 0.05
285 0.06
286 0.06
287 0.04
288 0.05
289 0.05
290 0.04
291 0.04
292 0.04
293 0.05
294 0.05
295 0.06
296 0.06
297 0.12
298 0.14
299 0.2
300 0.24
301 0.27
302 0.33
303 0.34
304 0.4
305 0.39
306 0.42
307 0.41
308 0.4
309 0.38
310 0.32
311 0.31
312 0.24
313 0.21
314 0.15
315 0.11
316 0.07
317 0.07
318 0.07
319 0.11
320 0.13
321 0.16
322 0.18
323 0.2
324 0.25
325 0.27
326 0.31
327 0.26
328 0.25
329 0.24
330 0.24
331 0.25
332 0.19
333 0.16
334 0.16
335 0.17
336 0.17
337 0.15
338 0.13
339 0.11
340 0.11
341 0.12
342 0.09
343 0.1
344 0.13
345 0.12
346 0.13
347 0.14
348 0.15
349 0.18
350 0.18
351 0.17
352 0.16
353 0.23
354 0.23
355 0.22
356 0.22
357 0.2
358 0.19
359 0.18
360 0.15
361 0.09
362 0.07
363 0.08
364 0.08
365 0.07
366 0.08
367 0.1
368 0.11
369 0.1
370 0.1
371 0.11
372 0.13
373 0.14
374 0.15
375 0.14
376 0.15
377 0.17
378 0.17
379 0.16
380 0.15
381 0.13
382 0.14
383 0.16
384 0.15
385 0.14
386 0.14
387 0.15
388 0.16
389 0.16
390 0.15
391 0.13
392 0.14
393 0.13
394 0.13
395 0.13
396 0.14
397 0.13
398 0.18
399 0.18
400 0.18
401 0.19
402 0.21
403 0.25
404 0.25
405 0.26
406 0.23
407 0.22
408 0.22
409 0.24
410 0.23
411 0.17
412 0.2
413 0.21
414 0.23
415 0.28
416 0.27
417 0.27
418 0.27
419 0.27
420 0.28
421 0.26
422 0.22
423 0.18
424 0.21
425 0.21
426 0.22
427 0.21
428 0.16
429 0.15
430 0.14
431 0.12
432 0.09
433 0.06
434 0.06
435 0.06
436 0.1
437 0.12
438 0.12
439 0.13
440 0.15
441 0.17
442 0.17
443 0.18
444 0.19
445 0.18
446 0.18
447 0.18
448 0.17
449 0.14
450 0.16
451 0.21
452 0.23
453 0.24
454 0.27
455 0.31
456 0.32
457 0.37
458 0.36
459 0.3
460 0.27
461 0.27
462 0.28
463 0.24
464 0.21
465 0.17
466 0.16
467 0.15
468 0.12
469 0.1
470 0.06
471 0.06
472 0.06
473 0.06
474 0.05
475 0.05
476 0.05
477 0.06
478 0.08
479 0.11
480 0.14
481 0.19