Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T6ZHC1

Protein Details
Accession A0A2T6ZHC1   
Localization Confidence Medium
Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
275-298TLIARSTPERKRKKSGFLRRDTAGHydrophilic
NLS Segment(s)
PositionSequence
284-288RKRKK
Subcellular Location(s) nucl 12.5, cyto_nucl 11.833, cyto 10, cyto_mito 7.333
Family & Domain DBs
Amino Acid Sequences MSFGHDSILSRGSSGSREGLAMNWVLDHVLAYPATYDFALPLRTIYTLNSTTPHTSPADFKLLLLEHISNLPSQPCTLPPSFLCTFIRKCFPRDLENVQFDQALTALDYIRDLEIRRSKELEKAARARGEGDRRIVNLRIKSIRTEQFYARAIAGIRRWTLLHELSITPFNKFNCIAILNTLYPIEESDVNSYLPAPTLASQRHALWRYITGVEKNGPGILESVRTSNGGWTGVSEAVNAYLRLSLDMIQKADELARPSSIGSFQSDDSMDMSATLIARSTPERKRKKSGFLRRDTAGSEASEEEDGKASTLERIVRGLARLGSSQHPGPPKKLYESDTGSEEDFPMRYN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.15
4 0.16
5 0.16
6 0.16
7 0.17
8 0.16
9 0.13
10 0.11
11 0.1
12 0.1
13 0.09
14 0.08
15 0.07
16 0.08
17 0.07
18 0.07
19 0.08
20 0.08
21 0.1
22 0.09
23 0.09
24 0.08
25 0.1
26 0.11
27 0.1
28 0.11
29 0.11
30 0.12
31 0.13
32 0.13
33 0.17
34 0.18
35 0.19
36 0.2
37 0.22
38 0.25
39 0.25
40 0.27
41 0.23
42 0.23
43 0.25
44 0.27
45 0.3
46 0.26
47 0.25
48 0.26
49 0.25
50 0.24
51 0.23
52 0.19
53 0.14
54 0.15
55 0.16
56 0.12
57 0.13
58 0.13
59 0.12
60 0.12
61 0.13
62 0.13
63 0.19
64 0.19
65 0.21
66 0.2
67 0.27
68 0.26
69 0.29
70 0.29
71 0.29
72 0.33
73 0.34
74 0.43
75 0.38
76 0.4
77 0.45
78 0.46
79 0.46
80 0.48
81 0.52
82 0.51
83 0.53
84 0.51
85 0.43
86 0.39
87 0.33
88 0.27
89 0.19
90 0.11
91 0.07
92 0.06
93 0.06
94 0.05
95 0.06
96 0.06
97 0.06
98 0.07
99 0.08
100 0.14
101 0.21
102 0.24
103 0.26
104 0.29
105 0.3
106 0.34
107 0.41
108 0.4
109 0.41
110 0.44
111 0.46
112 0.45
113 0.44
114 0.41
115 0.4
116 0.4
117 0.36
118 0.33
119 0.3
120 0.3
121 0.32
122 0.33
123 0.32
124 0.27
125 0.3
126 0.31
127 0.3
128 0.32
129 0.36
130 0.37
131 0.36
132 0.37
133 0.33
134 0.33
135 0.34
136 0.32
137 0.25
138 0.21
139 0.17
140 0.16
141 0.17
142 0.15
143 0.14
144 0.13
145 0.13
146 0.13
147 0.16
148 0.14
149 0.13
150 0.12
151 0.12
152 0.13
153 0.18
154 0.17
155 0.15
156 0.17
157 0.16
158 0.17
159 0.17
160 0.16
161 0.12
162 0.13
163 0.12
164 0.11
165 0.13
166 0.1
167 0.11
168 0.1
169 0.08
170 0.07
171 0.07
172 0.07
173 0.06
174 0.07
175 0.08
176 0.09
177 0.09
178 0.09
179 0.09
180 0.08
181 0.07
182 0.07
183 0.05
184 0.06
185 0.1
186 0.11
187 0.14
188 0.15
189 0.16
190 0.23
191 0.24
192 0.23
193 0.2
194 0.21
195 0.21
196 0.22
197 0.22
198 0.17
199 0.17
200 0.18
201 0.17
202 0.16
203 0.14
204 0.12
205 0.1
206 0.1
207 0.08
208 0.09
209 0.09
210 0.1
211 0.1
212 0.1
213 0.1
214 0.1
215 0.11
216 0.09
217 0.09
218 0.08
219 0.1
220 0.1
221 0.1
222 0.09
223 0.08
224 0.09
225 0.1
226 0.09
227 0.08
228 0.08
229 0.08
230 0.08
231 0.09
232 0.11
233 0.14
234 0.16
235 0.16
236 0.15
237 0.15
238 0.15
239 0.16
240 0.15
241 0.14
242 0.13
243 0.13
244 0.13
245 0.13
246 0.14
247 0.14
248 0.13
249 0.13
250 0.14
251 0.13
252 0.15
253 0.15
254 0.15
255 0.14
256 0.13
257 0.1
258 0.09
259 0.09
260 0.08
261 0.08
262 0.07
263 0.06
264 0.06
265 0.08
266 0.12
267 0.19
268 0.27
269 0.37
270 0.48
271 0.55
272 0.65
273 0.71
274 0.78
275 0.81
276 0.84
277 0.84
278 0.83
279 0.82
280 0.74
281 0.69
282 0.6
283 0.51
284 0.42
285 0.32
286 0.25
287 0.2
288 0.19
289 0.17
290 0.16
291 0.14
292 0.14
293 0.13
294 0.11
295 0.11
296 0.1
297 0.11
298 0.14
299 0.16
300 0.15
301 0.16
302 0.18
303 0.19
304 0.2
305 0.22
306 0.2
307 0.2
308 0.2
309 0.22
310 0.24
311 0.26
312 0.27
313 0.29
314 0.37
315 0.38
316 0.42
317 0.47
318 0.48
319 0.51
320 0.54
321 0.53
322 0.52
323 0.55
324 0.53
325 0.48
326 0.45
327 0.39
328 0.34
329 0.31
330 0.25